› › Gigastasin

Gigastasin in PDB entry 5ubm, assembly 1, front view.
Gigastasin in PDB entry 5ubm, assembly 1, side view.
Gigastasin in PDB entry 5ubm, assembly 1, top view.
Chain: I
Length: 137 amino acids
Theoretical weight: 16.1 KDa
Source organism: Haementeria ghilianii
Expression system: Trichoplusia ni
FASTA Sequence
>pdb|5ubm|I
AHHHHHHTSGDDDDKAKKKLPKCQKQEDCGSWDLKCNNVTKKCECRNQVCGRGCPKERYQRDKYGCRKCLCKGCDGFKCRLGCTYGFKTDKKGCEAFCTCNTKETACVNIWCTDPYKCNPESGRCEDPNEEYEYDYE
1137102030405060708090100110120130
 
50100
Chains
RSRZ Outlier Chain C (auth I)
Chain C (auth I)
Domains
Secondary structure
Flexibility predictions
Early folding residue predictions
Interaction interfaces
Loading...
 
 
  5ubm: 

WebGL does not seem to be available.

This can be caused by an outdated browser, graphics card driver issue, or bad weather. Sometimes, just restarting the browser helps. Also, make sure hardware acceleration is enabled in your browser.

For a list of supported browsers, refer to http://caniuse.com/#feat=webgl.

Quick links

Search similar proteins