› › Structure analysis

Solution NMR Structure of NERD-S, a natively folded pentamutant of the B1 domain of streptococcal protein G (GB1) with a solvent-exposed Trp43

Solution NMR
PDB entry 5ubs coloured by chain, ensemble of 10 models, front view.
PDB entry 5ubs coloured by chain, ensemble of 10 models, side view.
PDB entry 5ubs coloured by chain, ensemble of 10 models, top view.
Source organism: Streptococcus sp. GX7805
Assembly composition:
monomeric (preferred)
Entry contents: 1 distinct polypeptide molecule

Quick links

Assemblies

Assembly 1 (preferred)
Download    3D Visualisation
Assembly Name: Immunoglobulin G-binding protein G
hide full assembly name
Multimeric state: monomeric
Accessible surface area: 4024.23 Å2
Buried surface area: 0.0 Å2
Dissociation area: 0 Å2
Dissociation energy (ΔGdiss): 0 kcal/mol
Dissociation entropy (TΔSdiss): 0 kcal/mol
Symmetry number: 1
PDBe Complex ID: PDB-CPX-148791

Macromolecules

Immunoglobulin G-binding protein G
Chain: A
Length: 56 amino acids
Theoretical weight: 6.29 KDa
Source organism: Streptococcus sp. GX7805
Expression system: Escherichia coli
UniProt:
  • Canonical: P19909 (Residues: 373-427; Coverage: 10%)
Gene name: spg
Pfam: B domain
InterPro: IgG-binding B
CATH: Ubiquitin-like (UB roll)
Immunoglobulin G-binding protein G in PDB entry 5ubs, assembly 1, front view.
Immunoglobulin G-binding protein G in PDB entry 5ubs, assembly 1, side view.
Immunoglobulin G-binding protein G in PDB entry 5ubs, assembly 1, top view.
PDBe-KB: UniProt Coverage View: P19909  
156510152025303540455055
 
2040MTFKLIINGKTLKGETTTEAVDAATAEKVFKQYFNDNGIDGEWTYDDATKTFTITE
UniProt
P19909
Chains
Domains
Secondary structure
Flexibility predictions
Early folding residue predictions
Sequence conservation
Molecule details ›

Search similar proteins

Quick links