› › Structure analysis

Crystal structure of AL1 PHD finger bound to H3K4me3

X-ray diffraction
2.409Å resolution
PDB entry 5y20 coloured by chain, front view.
PDB entry 5y20 coloured by chain, side view.
PDB entry 5y20 coloured by chain, top view.
Source organisms:
Assembly composition:
hetero dimer (preferred)
Entry contents: 2 distinct polypeptide molecules

Quick links

Assemblies

Assembly 1 (preferred)
Download    3D Visualisation
Assembly Name: Histone H3.1 and PHD finger protein ALFIN-LIKE 1
hide full assembly name
Multimeric state: hetero dimer
Accessible surface area: 3849.1 Å2
Buried surface area: 1081.11 Å2
Dissociation area: 540.56 Å2
Dissociation energy (ΔGdiss): 1.82 kcal/mol
Dissociation entropy (TΔSdiss): 6.54 kcal/mol
Symmetry number: 1
PDBe Complex ID: PDB-CPX-159443

Macromolecules

PHD finger protein ALFIN-LIKE 1
Chain: A
Length: 52 amino acids
Theoretical weight: 5.87 KDa
Source organism: Arabidopsis thaliana
Expression system: Escherichia coli BL21(DE3)
UniProt:
  • Canonical: Q9FFF5 (Residues: 185-236; Coverage: 22%)
Gene names: AL1, At5g05610, MOP10.15
Pfam: PHD-finger
InterPro:
CATH: Zinc/RING finger domain, C3HC4 (zinc finger)
PHD finger protein ALFIN-LIKE 1 in PDB entry 5y20, assembly 1, front view.
PHD finger protein ALFIN-LIKE 1 in PDB entry 5y20, assembly 1, side view.
PHD finger protein ALFIN-LIKE 1 in PDB entry 5y20, assembly 1, top view.
PDBe-KB: UniProt Coverage View: Q9FFF5  
1525101520253035404550
 
2040DTLCGSCGGNYTNDEFWICCDVCERWYHGKCVKITPAKAESIKQYKCPSCCT
UniProt
Q9FFF5
Chains
Domains
Secondary structure
Flexibility predictions
Early folding residue predictions
Ligand binding sites
Interaction interfaces
Sequence conservation
Molecule details ›

Search similar proteins

Histone H3.1
Chain: P
Length: 7 amino acids
Theoretical weight: 819 Da
Source organism: Homo sapiens
Expression system: Not provided
UniProt:
  • Canonical: P68431 (Residues: 2-8; Coverage: 5%)
Gene names: H3C1, H3C10, H3C11, H3C12, H3C2, H3C3, H3C4, H3C6, H3C7, H3C8, H3FA, H3FB, H3FC HIST1H3C, H3FD, H3FF, H3FH, H3FI, H3FJ, H3FK, H3FL, HIST1H3A, HIST1H3B, HIST1H3D, HIST1H3E, HIST1H3F, HIST1H3G, HIST1H3H, HIST1H3I, HIST1H3J
Histone H3.1 in PDB entry 5y20, assembly 1, front view.
Histone H3.1 in PDB entry 5y20, assembly 1, side view.
Histone H3.1 in PDB entry 5y20, assembly 1, top view.
PDBe-KB: UniProt Coverage View: P68431  
171.01.52.02.53.03.54.04.55.05.56.06.57.0
 
2468ART*QTA
UniProt
P68431
Chains
Secondary structure
Flexibility predictions
Interaction interfaces
Molecule details ›

Search similar proteins

Quick links