› › Structure analysis

Crystal structure of the fifth immunoglobulin domain (Ig5) of human Robo1 in complex with the Fab fragment of murine monoclonal antibody B5209B

X-ray diffraction
2Å resolution
PDB entry 6a77 coloured by chain, front view.
PDB entry 6a77 coloured by chain, side view.
PDB entry 6a77 coloured by chain, top view.
Source organisms:
Assembly composition:
hetero trimer (preferred)
Entry contents: 3 distinct polypeptide molecules

Quick links

Assemblies

Assembly 1 (preferred)
Download    3D Visualisation
Assembly Name: Roundabout homolog 1 and IG-light kappa chain and IG-heavy chain
hide full assembly name
Multimeric state: hetero trimer
Accessible surface area: 23039.65 Å2
Buried surface area: 5075.34 Å2
Dissociation area: 814.72 Å2
Dissociation energy (ΔGdiss): 1.6 kcal/mol
Dissociation entropy (TΔSdiss): 11.55 kcal/mol
Symmetry number: 1
PDBe Complex ID: PDB-CPX-212894

Macromolecules

Roundabout homolog 1
Chain: A
Length: 91 amino acids
Theoretical weight: 9.78 KDa
Source organism: Homo sapiens
Expression system: Escherichia coli
UniProt:
  • Canonical: Q9Y6N7 (Residues: 455-543; Coverage: 6%)
Gene names: DUTT1, ROBO1
Pfam: Immunoglobulin domain
InterPro:
CATH: Immunoglobulins
Roundabout homolog 1 in PDB entry 6a77, assembly 1, front view.
Roundabout homolog 1 in PDB entry 6a77, assembly 1, side view.
Roundabout homolog 1 in PDB entry 6a77, assembly 1, top view.
PDBe-KB: UniProt Coverage View: Q9Y6N7  
191102030405060708090
 
20406080MGPVIRQGPVNQTVAVDGTFVLSCVATGSPVPTILWRKDGVLVSTQDSRIKQLENGVLQIRYAKLGDTGRYTCIASTPSGEATWSAYIEVQ
UniProt
Q9Y6N7
Chains
Domains
Secondary structure
Flexibility predictions
Sequence conservation
Molecule details ›

Search similar proteins

Light chain of the anti-human Robo1 antibody B5209B Fab
Chain: L
Length: 211 amino acids
Theoretical weight: 23.1 KDa
Source organism: Mus musculus
Expression system: Homo sapiens
InterPro:
CATH: Immunoglobulins
Light chain of the anti-human Robo1 antibody B5209B Fab in PDB entry 6a77, assembly 1, front view.
Light chain of the anti-human Robo1 antibody B5209B Fab in PDB entry 6a77, assembly 1, side view.
Light chain of the anti-human Robo1 antibody B5209B Fab in PDB entry 6a77, assembly 1, top view.
121120406080100120140160180200
 
50100150200DIQMTQSPASLSASVGETVTITCGASENIYGALTWYQRKQGKSPQLLIYGAINLADDKSSRFSGSGSGRQYSLKISSLHPDDVATYYCQNVLSTPFTFGSGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNR
Chains
RSRZ Outlier Chain B (auth L)
Chain B (auth L)
Domains
Secondary structure
Flexibility predictions
Interaction interfaces
Sequence conservation
Molecule details ›

Search similar proteins

Heavy chain of the anti-human Robo1 antibody B5209B Fab
Chain: H
Length: 221 amino acids
Theoretical weight: 23.5 KDa
Source organism: Mus musculus
Expression system: Homo sapiens
InterPro:
Heavy chain of the anti-human Robo1 antibody B5209B Fab in PDB entry 6a77, assembly 1, front view.
Heavy chain of the anti-human Robo1 antibody B5209B Fab in PDB entry 6a77, assembly 1, side view.
Heavy chain of the anti-human Robo1 antibody B5209B Fab in PDB entry 6a77, assembly 1, top view.
122120406080100120140160180200220
 
100200EVQLVESGGGVVQPGGSLKLSCAASGFTFSTYDMSWVRQTPDKRLELVATINSNGGSTYYPDSVKGRFTSSRDNAKNILYLQMSSLKSEDTAMYYCAREALLRPPYYALDYWGQGTSVTVSSAKTTPPSVYPLAPGCGDTTGSSVTLGCLVKGYFPESVTVTWNSGSLSSSVHTFPALLQSGLYTMSSSVTVPSSTWPSQTVTCSVAHPASSTTVDKKLEP
Chains
RSRZ Outlier Chain C (auth H)
Chain C (auth H)
Domains
Secondary structure
Flexibility predictions
Interaction interfaces
Sequence conservation
Molecule details ›

Search similar proteins

Quick links