Potassium voltage-gated channel subfamily KQT member 2 in PDB entry 6feh ‹ PDBe

Chain: A
Length: 115 amino acids
Theoretical weight: 13.6 KDa
Source organism: Homo sapiens
Expression system: Escherichia coli
UniProt:

Canonical: O43526 (Residues: 326-372, 530-560; Coverage: 9%)

Gene name: KCNQ2
FASTA Sequence


    >pdb|6feh|A

MSYYHHHHHHDYDIPTTENLYFQGAMGILGSGQKHFEKRRNPAAGLIQSAWRFYATNLSRTDLHSTWQYYERTVTVPMYRGLEDLTPGLKVSIRAVCVMRFLVSKRKFKESLRLD

PDBe-KB: UniProt Coverage View: O43526

Loading Protvista...

6feh:

WebGL does not seem to be available.

This can be caused by an outdated browser, graphics card driver issue, or bad weather. Sometimes, just restarting the browser helps. Also, make sure hardware acceleration is enabled in your browser.

For a list of supported browsers, refer to http://caniuse.com/#feat=webgl.