› › light chain variable region of Fab 14B10

light chain variable region of Fab 14B10 in PDB entry 6lhp, assembly 1, front view.
light chain variable region of Fab 14B10 in PDB entry 6lhp, assembly 1, side view.
light chain variable region of Fab 14B10 in PDB entry 6lhp, assembly 1, top view.
Chain: L
Length: 107 amino acids
Theoretical weight: 11.67 KDa
Source organism: Mus musculus
FASTA Sequence
>pdb|6lhp|L
DIQMTQSSSYLSVSLGGRVTITCKASDHINNWLAWYQQKPGNAPRLLISGATSLETGIPSRFSGSGSGKDYTLSITSLQTEDVGTYYCQQYWSTPTFGGGTKLEIKR

Quick links

Search similar proteins