› › Antibody DF2F-b.04 heavy chain

Antibody DF2F-b.04 heavy chain in PDB entry 6p7h, assembly 1, front view.
Antibody DF2F-b.04 heavy chain in PDB entry 6p7h, assembly 1, side view.
Antibody DF2F-b.04 heavy chain in PDB entry 6p7h, assembly 1, top view.
Chain: A
Length: 226 amino acids
Theoretical weight: 24.17 KDa
Source organism: Platyrrhini
Expression system: Homo sapiens
FASTA Sequence
>pdb|6p7h|A
QVQLQESGPGVVKPSETLSLTCAVSGGTISSGSYYWSWIRQPPGKGLEWIGGIYINNKSINYNPSLRGRVTISIDTSKNQFSLKLSAVTAADTAVYYCRRDPISSTIEEFDYWGQGVLVTVSSASTKGPSVFPLAPSSRSTSESTAALGCLVKDYFPEPVTVSWNSGSLTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYVCNVNHKPSNTKVDKRVEIKTC
122620406080100120140160180200220
 
100200
Chains
RSRZ Outlier Chain B (auth A)
Chain B (auth A)
Domains
Secondary structure
Sequence conservation
Loading...
 
 
  6p7h: 

WebGL does not seem to be available.

This can be caused by an outdated browser, graphics card driver issue, or bad weather. Sometimes, just restarting the browser helps. Also, make sure hardware acceleration is enabled in your browser.

For a list of supported browsers, refer to http://caniuse.com/#feat=webgl.

Quick links

Search similar proteins