PDBe-KB: UniProt Coverage View:
W5PB27
![NADH dehydrogenase [ubiquinone] iron-sulfur protein 3, mitochondrial in PDB entry 6q9d, assembly 1, front view.](https://www.ebi.ac.uk/pdbe/static/entry/6q9d_entity_5_front_image-200x200.png "Hetero 18-meric assembly 1 of PDB entry <span class='highlight'>6q9d</span> contains 1 copy of <span class='highlight'>NADH dehydrogenase [ubiquinone] iron-sulfur protein 3, mitochondrial</span>. Front view.")
![NADH dehydrogenase [ubiquinone] iron-sulfur protein 3, mitochondrial in PDB entry 6q9d, assembly 1, side view.](https://www.ebi.ac.uk/pdbe/static/entry/6q9d_entity_5_side_image-200x200.png "Hetero 18-meric assembly 1 of PDB entry <span class='highlight'>6q9d</span> contains 1 copy of <span class='highlight'>NADH dehydrogenase [ubiquinone] iron-sulfur protein 3, mitochondrial</span>. Side view.")
![NADH dehydrogenase [ubiquinone] iron-sulfur protein 3, mitochondrial in PDB entry 6q9d, assembly 1, top view.](https://www.ebi.ac.uk/pdbe/static/entry/6q9d_entity_5_top_image-200x200.png "Hetero 18-meric assembly 1 of PDB entry <span class='highlight'>6q9d</span> contains 1 copy of <span class='highlight'>NADH dehydrogenase [ubiquinone] iron-sulfur protein 3, mitochondrial</span>. Top view.")
Chain: S3
Length: 228 amino acids
Theoretical weight: 26.44 KDa
Source organism: Ovis aries
UniProt:
FASTA Sequence
Length: 228 amino acids
Theoretical weight: 26.44 KDa
Source organism: Ovis aries
UniProt:
- Canonical: W5PB27 (Residues: 39-266; Coverage: 86%)
FASTA Sequence
>pdb|6q9d|S3
ESASADTRPTVRPRNDVAHKQLSAFGEYVAEILPKYVQQVQVSCFSELEICIHPDGVIPVLTFLRDHSNAQFKSLADLTAVDIPTRQNRFEIVYNLLSLRFNSRIRVKTYTDELTPVESSVSVYKAANWYEREIWDMFGVFFANHPDLRRILTDYGFEGHPFRKDFPLSGYVELRYDDEVKRVVAEPVELAQEFRKFDLNSPWEAFPAYRQPPESLKLEAGDKKPEAK
PDBe-KB: UniProt Coverage View:
W5PB27