PDBe-KB: UniProt Coverage View:
W5Q1B0
![NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 8, mitochondrial in PDB entry 6qcf, assembly 1, front view.](https://www.ebi.ac.uk/pdbe/static/entry/6qcf_entity_40_front_image-200x200.png "Hetero 45-meric assembly 1 of PDB entry <span class='highlight'>6qcf</span> contains 1 copy of <span class='highlight'>NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 8, mitochondrial</span>. Front view.")
![NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 8, mitochondrial in PDB entry 6qcf, assembly 1, side view.](https://www.ebi.ac.uk/pdbe/static/entry/6qcf_entity_40_side_image-200x200.png "Hetero 45-meric assembly 1 of PDB entry <span class='highlight'>6qcf</span> contains 1 copy of <span class='highlight'>NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 8, mitochondrial</span>. Side view.")
![NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 8, mitochondrial in PDB entry 6qcf, assembly 1, top view.](https://www.ebi.ac.uk/pdbe/static/entry/6qcf_entity_40_top_image-200x200.png "Hetero 45-meric assembly 1 of PDB entry <span class='highlight'>6qcf</span> contains 1 copy of <span class='highlight'>NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 8, mitochondrial</span>. Top view.")
Chain: B8
Length: 158 amino acids
Theoretical weight: 18.82 KDa
Source organism: Ovis aries
UniProt:
FASTA Sequence
Length: 158 amino acids
Theoretical weight: 18.82 KDa
Source organism: Ovis aries
UniProt:
- Canonical: W5Q1B0 (Residues: 29-186; Coverage: 85%)
FASTA Sequence
>pdb|6qcf|B8
ASHITKDMLPGPYPKTPEERAAAAKKYNMRVEDYEPYPDDGMGYGDYPKLPDRSQQERDPWYDWDHPDLRLNWGEPMHWDLDMYIRNRVDTSPTPVNWNLMCKHLFGFVAFMLFMFWVGETYPTYQPVGPKQYPYNNLYLERGGDPNKEPEPVVHYEI
PDBe-KB: UniProt Coverage View:
W5Q1B0