› › Subunit of the SAGA and SAGA-like transcriptional regulatory complexes, interacts with Spt15p to act

Subunit of the SAGA and SAGA-like transcriptional regulatory complexes, interacts with Spt15p to act in PDB entry 6tb4, assembly 1, front view.
Subunit of the SAGA and SAGA-like transcriptional regulatory complexes, interacts with Spt15p to act in PDB entry 6tb4, assembly 1, side view.
Subunit of the SAGA and SAGA-like transcriptional regulatory complexes, interacts with Spt15p to act in PDB entry 6tb4, assembly 1, top view.
Chain: D
Length: 341 amino acids
Theoretical weight: 39.03 KDa
Source organism: Komagataella phaffii GS115
UniProt:
  • Canonical: C4R3E4 (Residues: 1-341; Coverage: 100%)
Gene name: PAS_chr3_0051
FASTA Sequence
>pdb|6tb4|D
MTDAKDKDHKYRYRMEIQQMMFVSGETNDPPVETTSLIEDIVRSQVVEIVLHSSQTALSRGTKSIVPEDVIFLIRHDKAKVNRLRTYLSWKDVRKNAKDQQSGDLADIGGDDLLDNSTSQVAASGAPGAPGSSSSTSMDSKMLSKYKKSKIRLPWELQFVFTEQPLDTNEDDAEDEDERAATLASLKRLKTNDERTKNMTKEEYVHWSECRQASFTFRKAKRFREWCGLSHLAESRPSDDVIDILGFLTFEMVCSITEEALIVKMLEEQNGDLASSTTTIQKLQESHRKRKHLFDGPDKDVRPITSGHVLEAWRRLQKRNVEKKAIRNFQGGKLRSRVQLI
PDBe-KB: UniProt Coverage View: C4R3E4  

Quick links

Search similar proteins