PDBe-KB: UniProt Coverage View:
W5P9Q8
![NADH dehydrogenase [ubiquinone] 1 subunit C2 in PDB entry 6zkc, assembly 1, front view.](https://www.ebi.ac.uk/pdbe/static/entry/6zkc_entity_33_front_image-200x200.png "Hetero 45-meric assembly 1 of PDB entry <span class='highlight'>6zkc</span> contains 1 copy of <span class='highlight'>NADH dehydrogenase [ubiquinone] 1 subunit C2</span>. Front view.")
![NADH dehydrogenase [ubiquinone] 1 subunit C2 in PDB entry 6zkc, assembly 1, side view.](https://www.ebi.ac.uk/pdbe/static/entry/6zkc_entity_33_side_image-200x200.png "Hetero 45-meric assembly 1 of PDB entry <span class='highlight'>6zkc</span> contains 1 copy of <span class='highlight'>NADH dehydrogenase [ubiquinone] 1 subunit C2</span>. Side view.")
![NADH dehydrogenase [ubiquinone] 1 subunit C2 in PDB entry 6zkc, assembly 1, top view.](https://www.ebi.ac.uk/pdbe/static/entry/6zkc_entity_33_top_image-200x200.png "Hetero 45-meric assembly 1 of PDB entry <span class='highlight'>6zkc</span> contains 1 copy of <span class='highlight'>NADH dehydrogenase [ubiquinone] 1 subunit C2</span>. Top view.")
Chain: o
Length: 122 amino acids
Theoretical weight: 14.43 KDa
Source organism: Ovis aries
UniProt:
FASTA Sequence
Length: 122 amino acids
Theoretical weight: 14.43 KDa
Source organism: Ovis aries
UniProt:
- Canonical: W5P9Q8 (Residues: 1-122; Coverage: 100%)
FASTA Sequence
>pdb|6zkc|o
VTMMTGRQARAPLQFLPDEARSLPPPKLTDPRLAYIGFLGYCSGLIDNAIRRRPVLSAGLHRQFLYITSFVFVGYYLLKRQDYMYAVRDHDMFSYIKSHPEDFPEKDKKTYREVFEEFHPVR
PDBe-KB: UniProt Coverage View:
W5P9Q8