› › NT-193 Heavy chain

NT-193 Heavy chain in PDB entry 7e5o, assembly 1, front view.
NT-193 Heavy chain in PDB entry 7e5o, assembly 1, side view.
NT-193 Heavy chain in PDB entry 7e5o, assembly 1, top view.
Chain: H
Length: 244 amino acids
Theoretical weight: 26.2 KDa
Source organism: Homo sapiens
Expression system: Homo sapiens
FASTA Sequence
>pdb|7e5o|H
EVQLQQWGAGLLKPSETLSLTCAVYGGSFSGYYWSWIRQPPGKGLEWIGEINHSGSTNYNPSLKSRVTISVDTSKNQFSLKLSSVTAADTAVYYCARGWDLDYYYGMDVWGQGTTVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVEPKSCDKGSSLEVLFQGPLGHHHHHH
124420406080100120140160180200220240
 
100200
Chains
RSRZ Outlier Chain A (auth H)
Chain A (auth H)
Domains
Secondary structure
Interaction interfaces
Loading...
 
 
  7e5o: 

WebGL does not seem to be available.

This can be caused by an outdated browser, graphics card driver issue, or bad weather. Sometimes, just restarting the browser helps. Also, make sure hardware acceleration is enabled in your browser.

For a list of supported browsers, refer to http://caniuse.com/#feat=webgl.

Quick links

Search similar proteins