Acyl carrier protein in PDB entry 7l4e ‹ PDBe

Chain: B
Length: 78 amino acids
Theoretical weight: 8.65 KDa
Source organism: Escherichia coli K-12
Expression system: Escherichia coli BL21(DE3)
UniProt:

Canonical: P0A6A8 (Residues: 1-78; Coverage: 100%)

Gene names: JW1080, acpP, b1094
FASTA Sequence


    >pdb|7l4e|B

MSTIEERVKKIIGEQLGVKQEEVTNNASFVEDLGADSLDTVELVMALEEEFDTEIPDEEAEKITTVQAAIDYINGHQA

7l4e:B

WebGL does not seem to be available.

This can be caused by an outdated browser, graphics card driver issue, or bad weather. Sometimes, just restarting the browser helps. Also, make sure hardware acceleration is enabled in your browser.

For a list of supported browsers, refer to http://caniuse.com/#feat=webgl.