Large ribosomal subunit protein uL15

Chain: k
Length: 151 amino acids
Theoretical weight: 16.77 KDa
Source organism: Mycoplasmoides pneumoniae M129
UniProt:
  • Canonical: Q50300 (Residues: 1-151; Coverage: 100%)
Gene names: MP648, MPN_183, rplO
FASTA Sequence
>pdb|7p6z|k
MELNQLKSVPKARNHKTKTLGRGHGSGLGKTSGRGQKGQKARKSGLTRPGFEGGQTPLYRRLPKFGNARKGFLKQEWVVLNLNKIAKLKLDKINRASLIEKQVISAKSQLPIKLIGHTKLEKPLHFEVHKVSKQALKAVENANGSVKLLEK
PDBe-KB: UniProt Coverage View: Q50300  
Loading Protvista...
Loading...
 
 
  7p6z: 

WebGL does not seem to be available.

This can be caused by an outdated browser, graphics card driver issue, or bad weather. Sometimes, just restarting the browser helps. Also, make sure hardware acceleration is enabled in your browser.

For a list of supported browsers, refer to http://caniuse.com/#feat=webgl.