Nanobody 872 in PDB entry 7sp8 ‹ PDBe

Chain: B
Length: 134 amino acids
Theoretical weight: 14.78 KDa
Source organism: Lama glama
Expression system: Escherichia coli K-12

FASTA Sequence


    >pdb|7sp8|B

QVQLVESGGGLVQAGGSLKVSCAASGRAFKTYRMAWFRQAPGKEREFVSGISALETTYYADSVKGRFTISRDNTKNTVSLQMDSLKPEDTAVYYCAARRYGGTDYTTTGSYDYWGQGTQVTVSSHHHHHHEPEA

7sp8:

WebGL does not seem to be available.

This can be caused by an outdated browser, graphics card driver issue, or bad weather. Sometimes, just restarting the browser helps. Also, make sure hardware acceleration is enabled in your browser.

For a list of supported browsers, refer to http://caniuse.com/#feat=webgl.