› › SARS2-57 Fv light chain

SARS2-57 Fv light chain in PDB entry 7sww, assembly 1, front view.
SARS2-57 Fv light chain in PDB entry 7sww, assembly 1, side view.
SARS2-57 Fv light chain in PDB entry 7sww, assembly 1, top view.
Chain: L
Length: 112 amino acids
Theoretical weight: 12.38 KDa
Source organism: Mus musculus
FASTA Sequence
>pdb|7sww|L
DIVMSQSPSSLAVSVGEKVTMSCQSSQSLLYSNNEKNYLAWYQQKPGHSPKLLLYWASTRESGVPDRFTGSGSGTAFTLTISSVKAEDLAVYYCQQYYNYPYTFGGGTKLEI
1112102030405060708090100110
 
50100
Chains
Chain C (auth L)
Domains
Secondary structure
Interaction interfaces
Sequence conservation
 
NC
 
  7sww:L 

WebGL does not seem to be available.

This can be caused by an outdated browser, graphics card driver issue, or bad weather. Sometimes, just restarting the browser helps. Also, make sure hardware acceleration is enabled in your browser.

For a list of supported browsers, refer to http://caniuse.com/#feat=webgl.

Quick links

Search similar proteins