Large ribosomal subunit protein uL14

Chain: M
Length: 122 amino acids
Theoretical weight: 13.44 KDa
Source organism: Pseudomonas aeruginosa PAO1
UniProt:
  • Canonical: Q9HWE5 (Residues: 1-122; Coverage: 100%)
Gene names: PA4253, rplN
FASTA Sequence
>pdb|7unv|M
MIQTQSMLDVADNSGARRVMCIKVLGGSHRRYAGIGDIIKVTVKEAIPRGKVKKGQVMTAVVVRTKHGVRRTDGSIIRFDGNAAVLLNNKQEPIGTRIFGPVTRELRTEKFMKIVSLAPEVL
PDBe-KB: UniProt Coverage View: Q9HWE5  
Loading Protvista...
Loading...
 
 
  7unv: 

WebGL does not seem to be available.

This can be caused by an outdated browser, graphics card driver issue, or bad weather. Sometimes, just restarting the browser helps. Also, make sure hardware acceleration is enabled in your browser.

For a list of supported browsers, refer to http://caniuse.com/#feat=webgl.

Loading Protvista...