› › Large ribosomal subunit protein bL32

Large ribosomal subunit protein bL32 in PDB entry 7unv, assembly 1, front view.
Large ribosomal subunit protein bL32 in PDB entry 7unv, assembly 1, side view.
Large ribosomal subunit protein bL32 in PDB entry 7unv, assembly 1, top view.
Chain: 4
Length: 60 amino acids
Theoretical weight: 6.81 KDa
Source organism: Pseudomonas aeruginosa PAO1
UniProt:
  • Canonical: Q9HZN4 (Residues: 1-60; Coverage: 100%)
Gene names: PA2970, rpmF
FASTA Sequence
>pdb|7unv|4
MAVQQNKKSRSARDMRRSHDALESNALSVEKSTGEVHLRHHVSPDGFYRGRKVVDKGSDE
PDBe-KB: UniProt Coverage View: Q9HZN4  
Loading Protvista...
Loading...
 
 
  7unv:4 

WebGL does not seem to be available.

This can be caused by an outdated browser, graphics card driver issue, or bad weather. Sometimes, just restarting the browser helps. Also, make sure hardware acceleration is enabled in your browser.

For a list of supported browsers, refer to http://caniuse.com/#feat=webgl.

Quick links

Search similar proteins