› › single-chain antibody Fv fragment (scFv16)

single-chain antibody Fv fragment (scFv16) in PDB entry 7vgx, assembly 1, front view.
single-chain antibody Fv fragment (scFv16) in PDB entry 7vgx, assembly 1, side view.
single-chain antibody Fv fragment (scFv16) in PDB entry 7vgx, assembly 1, top view.
Chain: S
Length: 259 amino acids
Theoretical weight: 27.78 KDa
Source organism: Mus musculus
Expression system: Trichoplusia ni
FASTA Sequence
>pdb|7vgx|S
DVQLVESGGGLVQPGGSRKLSCSASGFAFSSFGMHWVRQAPEKGLEWVAYISSGSGTIYYADTVKGRFTISRDDPKNTLFLQMTSLRSEDTAMYYCVRSIYYYGSSPFDFWGQGTTLTVSSGGGGSGGGGSGGGGSDIVMTQATSSVPVTPGESVSISCRSSKSLLHSNGNTYLYWFLQRPGQSPQLLIYRMSNLASGVPDRFSGSGSGTAFTLTISRLEAEDVGVYYCMQHLEYPLTFGAGTKLELKAAAHHHHHHHH
125920406080100120140160180200220240
 
100200
Chains
Chain F (auth S)
Domains
Secondary structure
Interaction interfaces
Sequence conservation
Loading...
 
 
  7vgx: 

WebGL does not seem to be available.

This can be caused by an outdated browser, graphics card driver issue, or bad weather. Sometimes, just restarting the browser helps. Also, make sure hardware acceleration is enabled in your browser.

For a list of supported browsers, refer to http://caniuse.com/#feat=webgl.

Quick links

Search similar proteins