PDBe-KB: UniProt Coverage View:
F1S031
![NADH dehydrogenase [ubiquinone] iron-sulfur protein 6, mitochondrial in PDB entry 7w32, assembly 1, front view.](https://www.ebi.ac.uk/pdbe/static/entry/7w32_entity_18_front_image-200x200.png "Hetero 45-meric assembly 1 of PDB entry <span class='highlight'>7w32</span> contains 1 copy of <span class='highlight'>NADH dehydrogenase [ubiquinone] iron-sulfur protein 6, mitochondrial</span>. Front view.")
![NADH dehydrogenase [ubiquinone] iron-sulfur protein 6, mitochondrial in PDB entry 7w32, assembly 1, side view.](https://www.ebi.ac.uk/pdbe/static/entry/7w32_entity_18_side_image-200x200.png "Hetero 45-meric assembly 1 of PDB entry <span class='highlight'>7w32</span> contains 1 copy of <span class='highlight'>NADH dehydrogenase [ubiquinone] iron-sulfur protein 6, mitochondrial</span>. Side view.")
![NADH dehydrogenase [ubiquinone] iron-sulfur protein 6, mitochondrial in PDB entry 7w32, assembly 1, top view.](https://www.ebi.ac.uk/pdbe/static/entry/7w32_entity_18_top_image-200x200.png "Hetero 45-meric assembly 1 of PDB entry <span class='highlight'>7w32</span> contains 1 copy of <span class='highlight'>NADH dehydrogenase [ubiquinone] iron-sulfur protein 6, mitochondrial</span>. Top view.")
Chain: T
Length: 96 amino acids
Theoretical weight: 10.57 KDa
Source organism: Sus scrofa
UniProt:
FASTA Sequence
Length: 96 amino acids
Theoretical weight: 10.57 KDa
Source organism: Sus scrofa
UniProt:
- Canonical: F1S031 (Residues: 28-123; Coverage: 78%)
FASTA Sequence
>pdb|7w32|T
GVRTSPTGEKVTHTGQAYDDGDYRRVRFSDRQKEVNENFAIDLIAEQPVSEVGSRVISCDGGGGALGHPRVYINLDKETKTGTCGYCGLQFRQPHH
PDBe-KB: UniProt Coverage View:
F1S031