The latest features of this page are not supported in older IE browsers. Please update to IE11 or view this page in another browser (eg Chrome or Firefox) to access updated PDBe pages!
x
Chains: D, E, I Length: 117 amino acids Theoretical weight:
12.52 KDa Source organism:Homo sapiens Expression system:Homo sapiens
FASTA Sequence
>pdb|7xd2|D E I
EVQLVESGGGLIQPGGSLRLSCAVSGFTVSRMSWVRQAPGKGLECVSVIYTGGNTDYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTALYYCVRGSGGIHDAFDIWGQGTMVTVSS
Loading Protvista...
Loading...
7xd2:
WebGL does not seem to be available.
This can be caused by an outdated browser, graphics card driver issue, or bad weather. Sometimes, just restarting the browser helps. Also, make sure hardware acceleration is enabled in your browser.