› › H chain of antibody 10-5B

H chain of antibody 10-5B in PDB entry 7xd2, assembly 1, front view.
H chain of antibody 10-5B in PDB entry 7xd2, assembly 1, side view.
H chain of antibody 10-5B in PDB entry 7xd2, assembly 1, top view.
Chains: D, E, I
Length: 117 amino acids
Theoretical weight: 12.52 KDa
Source organism: Homo sapiens
Expression system: Homo sapiens
FASTA Sequence
>pdb|7xd2|D E I
EVQLVESGGGLIQPGGSLRLSCAVSGFTVSRMSWVRQAPGKGLECVSVIYTGGNTDYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTALYYCVRGSGGIHDAFDIWGQGTMVTVSS
 
NC
 
  7xd2:D 

WebGL does not seem to be available.

This can be caused by an outdated browser, graphics card driver issue, or bad weather. Sometimes, just restarting the browser helps. Also, make sure hardware acceleration is enabled in your browser.

For a list of supported browsers, refer to http://caniuse.com/#feat=webgl.

Quick links

Search similar proteins