› › Fab E7 heavy chain

Fab E7 heavy chain in PDB entry 7y71, assembly 1, front view.
Fab E7 heavy chain in PDB entry 7y71, assembly 1, side view.
Fab E7 heavy chain in PDB entry 7y71, assembly 1, top view.
Chain: O
Length: 221 amino acids
Theoretical weight: 23.34 KDa
Source organism: Homo sapiens
Expression system: Homo sapiens
FASTA Sequence
>pdb|7y71|O
QVQLQESGPGLVKPSETLSLTCTVSGGFIGPHYWSWVRQPPGKGLEWIGYIYISGSTNYNPSLKSRLTISVDMSKSQFSLTLSSATAADTAVYYCARGGGYLETGPFEYWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVEPK
122120406080100120140160180200220
 
100200
Chains
Chain B (auth O)
Domains
Secondary structure
Interaction interfaces
Sequence conservation
 
NC
 
  7y71:O 

WebGL does not seem to be available.

This can be caused by an outdated browser, graphics card driver issue, or bad weather. Sometimes, just restarting the browser helps. Also, make sure hardware acceleration is enabled in your browser.

For a list of supported browsers, refer to http://caniuse.com/#feat=webgl.

Quick links

Search similar proteins