Spike protein S1 in PDB entry 8dw3 ‹ PDBe

Chain: B
Length: 197 amino acids
Theoretical weight: 22.1 KDa
Source organism: Severe acute respiratory syndrome coronavirus 2
Expression system: Homo sapiens

FASTA Sequence


    >pdb|8dw3|B

PNITNLCPFGEVFNATRFASVYAWNRKRISNCVADYSVLYNSASFSTFKCYGVSPTKLNDLCFTNVYADSFVIRGDEVRQIAPGQTGKIADYNYKLPDDFTGCVIAWNSNNLDSKVGGNYNYLYRLFRKSNLKPFERDISTEIYQAGSTPCNGVEGFNCYFPLQSYGFQPTNGVGYQPYRVVVLSFELLHAPATVCG

8dw3:B

WebGL does not seem to be available.

This can be caused by an outdated browser, graphics card driver issue, or bad weather. Sometimes, just restarting the browser helps. Also, make sure hardware acceleration is enabled in your browser.

For a list of supported browsers, refer to http://caniuse.com/#feat=webgl.