PDBe-KB: UniProt Coverage View:
Q9VMU0
![NADH dehydrogenase [ubiquinone] iron-sulfur protein 6, mitochondrial in PDB entry 8esw, assembly 1, front view.](https://www.ebi.ac.uk/pdbe/static/entry/8esw_entity_2_front_image-200x200.png "Hetero 43-meric assembly 1 of PDB entry <span class='highlight'>8esw</span> contains 1 copy of <span class='highlight'>NADH dehydrogenase [ubiquinone] iron-sulfur protein 6, mitochondrial</span>. Front view.")
![NADH dehydrogenase [ubiquinone] iron-sulfur protein 6, mitochondrial in PDB entry 8esw, assembly 1, side view.](https://www.ebi.ac.uk/pdbe/static/entry/8esw_entity_2_side_image-200x200.png "Hetero 43-meric assembly 1 of PDB entry <span class='highlight'>8esw</span> contains 1 copy of <span class='highlight'>NADH dehydrogenase [ubiquinone] iron-sulfur protein 6, mitochondrial</span>. Side view.")
![NADH dehydrogenase [ubiquinone] iron-sulfur protein 6, mitochondrial in PDB entry 8esw, assembly 1, top view.](https://www.ebi.ac.uk/pdbe/static/entry/8esw_entity_2_top_image-200x200.png "Hetero 43-meric assembly 1 of PDB entry <span class='highlight'>8esw</span> contains 1 copy of <span class='highlight'>NADH dehydrogenase [ubiquinone] iron-sulfur protein 6, mitochondrial</span>. Top view.")
Chain: S6
Length: 126 amino acids
Theoretical weight: 14.38 KDa
Source organism: Drosophila melanogaster
UniProt:
FASTA Sequence
Length: 126 amino acids
Theoretical weight: 14.38 KDa
Source organism: Drosophila melanogaster
UniProt:
- Canonical: Q9VMU0 (Residues: 1-126; Coverage: 100%)
FASTA Sequence
>pdb|8esw|S6
MASKQLVNNLSKLGLPRQNWMSPLASVRHSSCRGDIEKVTHTGQVFDKEDYRNARFVNAKRYVNENWGIKLIEEVPPKECTERVVFCDGGDGPLGHPKVYINLDKPGNHICGYCGLRFVKKDDHHH
PDBe-KB: UniProt Coverage View:
Q9VMU0