› › TCR alpha chain

TCR alpha chain in PDB entry 8i5c, assembly 1, front view.
TCR alpha chain in PDB entry 8i5c, assembly 1, side view.
TCR alpha chain in PDB entry 8i5c, assembly 1, top view.
Chains: D, I, N, S, X, c, h, m, r, w
Length: 199 amino acids
Theoretical weight: 22.41 KDa
Source organism: Mus musculus
Expression system: Escherichia coli
FASTA Sequence
>pdb|8i5c|D I N S X c h m r w
QQKVQQSPESLIVPEGGMASLNCTSSDRNVDYFWWYRQHSGKSPKMLMSIFSNGEKEEGRFTVHLNKASLHTSLHIRDSQPSDSALYLCAARDSNYQLIWGSGTKLIIKPDIQNPDPAVYQLRDSKSSDKSVCLFTDFDSQTNVSQSKDSDVYITDKCVLDMRSMDFKSNSAVAWSNKSDFACANAFNNSIIPEDTFFP
119920406080100120140160180
 
50100150200
Chains
RSRZ Outlier Chain CA (auth c)
Chain CA (auth c)
RSRZ Outlier Chain D (auth D)
Chain D (auth D)
RSRZ Outlier Chain HA (auth h)
Chain HA (auth h)
RSRZ Outlier Chain I (auth I)
Chain I (auth I)
RSRZ Outlier Chain MA (auth m)
Chain MA (auth m)
RSRZ Outlier Chain N (auth N)
Chain N (auth N)
RSRZ Outlier Chain RA (auth r)
Chain RA (auth r)
RSRZ Outlier Chain S (auth S)
Chain S (auth S)
RSRZ Outlier Chain WA (auth w)
Chain WA (auth w)
RSRZ Outlier Chain X (auth X)
Chain X (auth X)
Domains
Secondary structure
Interaction interfaces
Loading...
 
 
  8i5c:D 

WebGL does not seem to be available.

This can be caused by an outdated browser, graphics card driver issue, or bad weather. Sometimes, just restarting the browser helps. Also, make sure hardware acceleration is enabled in your browser.

For a list of supported browsers, refer to http://caniuse.com/#feat=webgl.

119920406080100120140160180
 
50100150200
Predicted ligand binding sites
P2Rank

Quick links

Search similar proteins