› › Nanobody 35

Nanobody 35 in PDB entry 8kh5, assembly 1, front view.
Nanobody 35 in PDB entry 8kh5, assembly 1, side view.
Nanobody 35 in PDB entry 8kh5, assembly 1, top view.
Chain: E
Length: 160 amino acids
Theoretical weight: 17.35 KDa
Source organism: Lama glama
Expression system: Escherichia coli BL21(DE3)
FASTA Sequence
>pdb|8kh5|E
MKYLLPTAAAGLLLLAAQPAMAQVQLQESGGGLVQPGGSLRLSCAASGFTFSNYKMNWVRQAPGKGLEWVSDISQSGASISYTGSVKGRFTISRDNAKNTLYLQMNSLKPEDTAVYYCARCPAPFTRDCFDVTSTTYAYRGQGTQVTVSSHHHHHHEPEA
116020406080100120140160
 
50100150
Chains
Chain D (auth E)
Secondary structure
Interaction interfaces
Loading...
 
 
  8kh5:E 

WebGL does not seem to be available.

This can be caused by an outdated browser, graphics card driver issue, or bad weather. Sometimes, just restarting the browser helps. Also, make sure hardware acceleration is enabled in your browser.

For a list of supported browsers, refer to http://caniuse.com/#feat=webgl.

Quick links

Search similar proteins