Large ribosomal subunit protein bL28

Chain: v
Length: 58 amino acids
Theoretical weight: 6.37 KDa
Source organism: Bacillus subtilis
UniProt:
  • Canonical: P37807 (Residues: 3-60; Coverage: 94%)
Gene names: BSU15820, rpmB, yloT
FASTA Sequence
>pdb|8r55|v
RKCVITGKKTTAGNNRSHAMNASKRTWGANLQKVRILVNGKPKKVYVSARALKSGKVE
PDBe-KB: UniProt Coverage View: P37807  
Loading Protvista...
Loading...
 
 
  8r55: 

WebGL does not seem to be available.

This can be caused by an outdated browser, graphics card driver issue, or bad weather. Sometimes, just restarting the browser helps. Also, make sure hardware acceleration is enabled in your browser.

For a list of supported browsers, refer to http://caniuse.com/#feat=webgl.

Loading Protvista...