PDBe-KB: UniProt Coverage View:
A0A8D0K6B5
![NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 8 in PDB entry 8uex, assembly 1, front view.](https://www.ebi.ac.uk/pdbe/static/entry/8uex_entity_23_front_image-200x200.png "Hetero 45-meric assembly 1 of PDB entry <span class='highlight'>8uex</span> contains 1 copy of <span class='highlight'>NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 8</span>. Front view.")
![NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 8 in PDB entry 8uex, assembly 1, side view.](https://www.ebi.ac.uk/pdbe/static/entry/8uex_entity_23_side_image-200x200.png "Hetero 45-meric assembly 1 of PDB entry <span class='highlight'>8uex</span> contains 1 copy of <span class='highlight'>NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 8</span>. Side view.")
![NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 8 in PDB entry 8uex, assembly 1, top view.](https://www.ebi.ac.uk/pdbe/static/entry/8uex_entity_23_top_image-200x200.png "Hetero 45-meric assembly 1 of PDB entry <span class='highlight'>8uex</span> contains 1 copy of <span class='highlight'>NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 8</span>. Top view.")
Chain: 1X
Length: 172 amino acids
Theoretical weight: 20.06 KDa
Source organism: Sus scrofa
UniProt:
Length: 172 amino acids
Theoretical weight: 20.06 KDa
Source organism: Sus scrofa
UniProt:
- Canonical: A0A8D0K6B5 (Residues: 77-248; Coverage: 69%)
>pdb|8uex|1X
MPGIVELPTLEDLKVQEVKVSSSVLKAAAHHYGAQCDKPNKEFMLCRWEEKDPRRCLEEGKLVNQCALDFFRQIKRHCAEPFTEYWTCIDYSGLQLFRHCRKQQAKFDECVLDKLGWVRPDLGELSKVTKVKTDRPLPENPYHSRARPEPNPEAEGDLKPAKHGSRLFFWTM
PDBe-KB: UniProt Coverage View:
A0A8D0K6B5