PDBe-KB: UniProt Coverage View:
A0A286ZNN4
![NADH dehydrogenase [ubiquinone] iron-sulfur protein 3, mitochondrial in PDB entry 8uex, assembly 1, front view.](https://www.ebi.ac.uk/pdbe/static/entry/8uex_entity_3_front_image-200x200.png "Hetero 45-meric assembly 1 of PDB entry <span class='highlight'>8uex</span> contains 1 copy of <span class='highlight'>NADH dehydrogenase [ubiquinone] iron-sulfur protein 3, mitochondrial</span>. Front view.")
![NADH dehydrogenase [ubiquinone] iron-sulfur protein 3, mitochondrial in PDB entry 8uex, assembly 1, side view.](https://www.ebi.ac.uk/pdbe/static/entry/8uex_entity_3_side_image-200x200.png "Hetero 45-meric assembly 1 of PDB entry <span class='highlight'>8uex</span> contains 1 copy of <span class='highlight'>NADH dehydrogenase [ubiquinone] iron-sulfur protein 3, mitochondrial</span>. Side view.")
![NADH dehydrogenase [ubiquinone] iron-sulfur protein 3, mitochondrial in PDB entry 8uex, assembly 1, top view.](https://www.ebi.ac.uk/pdbe/static/entry/8uex_entity_3_top_image-200x200.png "Hetero 45-meric assembly 1 of PDB entry <span class='highlight'>8uex</span> contains 1 copy of <span class='highlight'>NADH dehydrogenase [ubiquinone] iron-sulfur protein 3, mitochondrial</span>. Top view.")
Chain: 1C
Length: 264 amino acids
Theoretical weight: 30.15 KDa
Source organism: Sus scrofa
UniProt:
FASTA Sequence
Length: 264 amino acids
Theoretical weight: 30.15 KDa
Source organism: Sus scrofa
UniProt:
- Canonical: A0A286ZNN4 (Residues: 1-264; Coverage: 100%)
FASTA Sequence
>pdb|8uex|1C
MAAAAAARGCWRGLVGPAAVARVSGRPSVLLLPVRKESAAADTRPTIRPRNDVVHKQLSAFGQYVAEILPKYVQQVQVSCFNELEIFIHPDGVIPVLTFLRDHTNAQFKSLADLTAVDVPTRQNRFEIVYNLLSLRFNSQIRVKTYTDELTPIESSVTVYKAANWYEREIWDMFGVFFANHPDLRRILTGYGFEGHPFRKDFPLSGYVELRYDDEVKRVVAEPVELAQEFRKFDLNSPWEAFPAYRQPPEDLKLEAGDKKPETK
PDBe-KB: UniProt Coverage View:
A0A286ZNN4