PDBe-KB: UniProt Coverage View:
A0A8D1EYI7
![NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 11, mitochondrial in PDB entry 8uex, assembly 1, front view.](https://www.ebi.ac.uk/pdbe/static/entry/8uex_entity_32_front_image-200x200.png "Hetero 45-meric assembly 1 of PDB entry <span class='highlight'>8uex</span> contains 1 copy of <span class='highlight'>NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 11, mitochondrial</span>. Front view.")
![NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 11, mitochondrial in PDB entry 8uex, assembly 1, side view.](https://www.ebi.ac.uk/pdbe/static/entry/8uex_entity_32_side_image-200x200.png "Hetero 45-meric assembly 1 of PDB entry <span class='highlight'>8uex</span> contains 1 copy of <span class='highlight'>NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 11, mitochondrial</span>. Side view.")
![NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 11, mitochondrial in PDB entry 8uex, assembly 1, top view.](https://www.ebi.ac.uk/pdbe/static/entry/8uex_entity_32_top_image-200x200.png "Hetero 45-meric assembly 1 of PDB entry <span class='highlight'>8uex</span> contains 1 copy of <span class='highlight'>NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 11, mitochondrial</span>. Top view.")
Chain: 1g
Length: 154 amino acids
Theoretical weight: 17.38 KDa
Source organism: Sus scrofa
UniProt:
Length: 154 amino acids
Theoretical weight: 17.38 KDa
Source organism: Sus scrofa
UniProt:
- Canonical: A0A8D1EYI7 (Residues: 1-154; Coverage: 100%)
>pdb|8uex|1g
MAAGVLGLCARRLLAAAATRGLPAARVRWESGSSRAVIAPSALVGKRPPEPTIRLQEDPDPEDENLYEKNPDSHGYDKDPIVDLWNMRVVFFFGFSIVLVLGSTFVAYLPDYRMQEWARREAERLVKYREANGLPLMESNCFDPNKIQLPEDED
PDBe-KB: UniProt Coverage View:
A0A8D1EYI7