14G6 Fab heavy chain

Chains: B, H
Length: 219 amino acids
Theoretical weight: 23.04 KDa
Source organism: Homo sapiens
Expression system: Homo sapiens
FASTA Sequence
>pdb|8uky|B H
EVKLVESGAELVRPGTSVKVSCKASGYAFTNYLIEWVKQRPGQGLEWIGVINPGSGGTNYNEKFKGKATLTADKSSSTAYMQLTSLTSDDSAVYFCASPSLYGSFDYWGQGTTVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVEPK
121920406080100120140160180200
 
100200
Chains
RSRZ Outlier Chain B (auth H)
Chain B (auth H)
RSRZ Outlier Chain E (auth B)
Chain E (auth B)
Secondary structure
Ligand binding sites
Interaction interfaces
Sequence conservation
Loading...
 
 
  8uky:B 

WebGL does not seem to be available.

This can be caused by an outdated browser, graphics card driver issue, or bad weather. Sometimes, just restarting the browser helps. Also, make sure hardware acceleration is enabled in your browser.

For a list of supported browsers, refer to http://caniuse.com/#feat=webgl.