Large ribosomal subunit protein uL24

Chain: X
Length: 105 amino acids
Theoretical weight: 11.23 KDa
Source organism: Mycolicibacterium smegmatis MC2 155
UniProt:
  • Canonical: A0QSG0 (Residues: 1-105; Coverage: 100%)
Gene names: MSMEG_1466, MSMEI_1430, rplX
FASTA Sequence
>pdb|8wi7|X
MKVHKGDTVLVISGKDKGAKGKVLVAYPDRNKVLVEGVNRIKKHTAVSANERGASSGGIVTQEAPIHVSNVMVVDSDGKPTRVGYRIDDETGKKVRIAKTNGKDI
PDBe-KB: UniProt Coverage View: A0QSG0  
Loading Protvista...
Loading...
 
 
  8wi7:X 

WebGL does not seem to be available.

This can be caused by an outdated browser, graphics card driver issue, or bad weather. Sometimes, just restarting the browser helps. Also, make sure hardware acceleration is enabled in your browser.

For a list of supported browsers, refer to http://caniuse.com/#feat=webgl.