› › Nanobody 35

Nanobody 35 in PDB entry 8xvi, assembly 1, front view.
Nanobody 35 in PDB entry 8xvi, assembly 1, side view.
Nanobody 35 in PDB entry 8xvi, assembly 1, top view.
Chain: N
Length: 157 amino acids
Theoretical weight: 17.06 KDa
Source organism: Lama glama
Expression system: Escherichia coli
FASTA Sequence
>pdb|8xvi|N
MKYLLPTAAAGLLLLAAQPAMAMQVQLQESGGGLVQPGGSLRLSCAASGFTFSNYKMNWVRQAPGKGLEWVSDISQSGASISYTGSVKGRFTISRDNAKNTLYLQMNSLKPEDTAVYYCARCPAPFTRDCFDVTSTTYAYRGQGTQVTVSSHHHHHH
115720406080100120140
 
50100150
Chains
Chain D (auth N)
Secondary structure
Interaction interfaces
Loading...
 
 
  8xvi: 

WebGL does not seem to be available.

This can be caused by an outdated browser, graphics card driver issue, or bad weather. Sometimes, just restarting the browser helps. Also, make sure hardware acceleration is enabled in your browser.

For a list of supported browsers, refer to http://caniuse.com/#feat=webgl.

Quick links

Search similar proteins