› › V-type proton ATPase 16 kDa proteolipid subunit c

V-type proton ATPase 16 kDa proteolipid subunit c in PDB entry 9brr, assembly 1, front view.
V-type proton ATPase 16 kDa proteolipid subunit c in PDB entry 9brr, assembly 1, side view.
V-type proton ATPase 16 kDa proteolipid subunit c in PDB entry 9brr, assembly 1, top view.
Chains: g, h, i, j, k, l, m, n, o
Length: 155 amino acids
Theoretical weight: 15.82 KDa
Source organism: Mus musculus
UniProt:
  • Canonical: P63082 (Residues: 1-155; Coverage: 100%)
Gene names: Atp6c, Atp6l, Atp6v0c, Atpl, Mvp
FASTA Sequence
>pdb|9brr|g h i j k l m n o
MADIKNNPEYSSFFGVMGASSAMVFSAMGAAYGTAKSGTGIAAMSVMRPELIMKSIIPVVMAGIIAIYGLVVAVLIANSLTDGITLYRSFLQLGAGLSVGLSGLAAGFAIGIVGDAGVRGTAQQPRLFVGMILILIFAEVLGLYGLIVALILSTK
PDBe-KB: UniProt Coverage View: P63082  
115520406080100120140
 
50100150
UniProt
P63082
Chains
Interaction interfaces
Sequence conservation
 
NC
 
  9brr:g 

WebGL does not seem to be available.

This can be caused by an outdated browser, graphics card driver issue, or bad weather. Sometimes, just restarting the browser helps. Also, make sure hardware acceleration is enabled in your browser.

For a list of supported browsers, refer to http://caniuse.com/#feat=webgl.

Quick links

Search similar proteins