› › Heavy chain of Fab ConD-852

Heavy chain of Fab ConD-852 in PDB entry 9l6c, assembly 1, front view.
Heavy chain of Fab ConD-852 in PDB entry 9l6c, assembly 1, side view.
Heavy chain of Fab ConD-852 in PDB entry 9l6c, assembly 1, top view.
Chain: A
Length: 123 amino acids
Theoretical weight: 13.73 KDa
Source organism: Homo sapiens
Expression system: Homo sapiens
FASTA Sequence
>pdb|9l6c|A
QVQLVESGGGVVQPGRSLRLSCAASGFTFSSYGMHWVRQAPGKGLEWVALIWFDGSNKYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCARDGLDLEWLFGLFDYWGQGTLVTVSS
1123102030405060708090100110120
 
50100
Chains
Chain A (auth A)
Secondary structure
Interaction interfaces
Loading...
 
 
  9l6c: 

WebGL does not seem to be available.

This can be caused by an outdated browser, graphics card driver issue, or bad weather. Sometimes, just restarting the browser helps. Also, make sure hardware acceleration is enabled in your browser.

For a list of supported browsers, refer to http://caniuse.com/#feat=webgl.

Quick links

Search similar proteins