Mothers against decapentaplegic homolog 3 in PDB entry 1mhd ‹ PDBe

Chains: A, B
Length: 132 amino acids
Theoretical weight: 15.54 KDa
Source organism: Homo sapiens
Expression system: Escherichia coli BL21(DE3)
UniProt:

Canonical: P84022 (Residues: 1-132; Coverage: 31%)

Gene names: MADH3, SMAD3
FASTA Sequence


    >pdb|1mhd|A B

MSSILPFTPPIVKRLLGWKKGEQNGQEEKWCEKAVKSLVKKLKKTGQLDELEKAITTQNVNTKCITIPRSLDGRLQVSHRKGLPHVIYCRLWRWPDLHSHHELRAMELCEFAFNMKKDEVCVNPYHYQRVET

PDBe-KB: UniProt Coverage View: P84022

Loading Protvista...

1mhd:

WebGL does not seem to be available.

This can be caused by an outdated browser, graphics card driver issue, or bad weather. Sometimes, just restarting the browser helps. Also, make sure hardware acceleration is enabled in your browser.

For a list of supported browsers, refer to http://caniuse.com/#feat=webgl.