› › Structure analysis

NMR structure family of Human Agouti Signalling Protein (80-132: Q115Y, S124Y)

Solution NMR
PDB entry 1y7k coloured by chain, ensemble of 21 models, front view.
PDB entry 1y7k coloured by chain, ensemble of 21 models, side view.
PDB entry 1y7k coloured by chain, ensemble of 21 models, top view.
Source organism: Homo sapiens
Assembly composition:
monomeric (preferred)
Entry contents: 1 distinct polypeptide molecule

Quick links

Assemblies

Assembly 1 (preferred)
Download    3D Visualisation
Assembly Name: Agouti-signaling protein
hide full assembly name
Multimeric state: monomeric
Accessible surface area: 3706.82 Å2
Buried surface area: 0.0 Å2
Dissociation area: 0 Å2
Dissociation energy (ΔGdiss): 0 kcal/mol
Dissociation entropy (TΔSdiss): 0 kcal/mol
Symmetry number: 1
PDBe Complex ID: PDB-CPX-154498

Macromolecules

Agouti-signaling protein
Chain: A
Length: 53 amino acids
Theoretical weight: 5.82 KDa
Source organism: Homo sapiens
Expression system: Not provided
UniProt:
  • Canonical: P42127 (Residues: 80-132; Coverage: 48%)
Gene names: AGTI, AGTIL, ASIP, ASP
Pfam: Agouti protein
InterPro:
CATH: Agouti domain
Agouti-signaling protein in PDB entry 1y7k, assembly 1, front view.
Agouti-signaling protein in PDB entry 1y7k, assembly 1, side view.
Agouti-signaling protein in PDB entry 1y7k, assembly 1, top view.
PDBe-KB: UniProt Coverage View: P42127  
1535101520253035404550
 
2040KKVVRPRTPLSAPCVATRNSCKPPAPACCDPCASCYCRFFRSACYCRVLSLNC
UniProt
P42127
Chains
Domains
Secondary structure
Flexibility predictions
Early folding residue predictions
Molecule details ›

Search similar proteins

Quick links