› › Structure analysis

Structure of a SecM-stalled E. coli ribosome complex obtained by fitting atomic models for RNA and protein components into cryo-EM map EMD-1143

Electron Microscopy
15Å resolution
PDB entry 4v4w coloured by chain, front view.
PDB entry 4v4w coloured by chain, side view.
PDB entry 4v4w coloured by chain, top view.
Source organism: Escherichia coli
Assembly composition:
hetero 52-mer (preferred)
Entry contents: 45 distinct polypeptide molecules
4 distinct RNA molecules

Quick links

Assemblies

Assembly 1 (preferred)
Download    3D Visualisation
Assembly Name: ribosomal protein and RNA
hide full assembly name
Multimeric state: hetero 52-mer
Accessible surface area: 942415.93 Å2
Buried surface area: 145079.53 Å2
Dissociation area: 2,765.81 Å2
Dissociation energy (ΔGdiss): -36.33 kcal/mol
Dissociation entropy (TΔSdiss): 84.68 kcal/mol
Symmetry number: 1
PDBe Complex ID: PDB-CPX-135579

Macromolecules

Small ribosomal subunit protein uS2
Chain: AB
Length: 236 amino acids
Theoretical weight: 26.29 KDa
Source organism: Escherichia coli
UniProt:
  • Canonical: P0A7V0 (Residues: 6-241; Coverage: 98%)
Gene names: JW0164, b0169, rpsB
Pfam: Ribosomal protein S2
InterPro:
Small ribosomal subunit protein uS2 in PDB entry 4v4w, assembly 1, front view.
Small ribosomal subunit protein uS2 in PDB entry 4v4w, assembly 1, side view.
Small ribosomal subunit protein uS2 in PDB entry 4v4w, assembly 1, top view.
PDBe-KB: UniProt Coverage View: P0A7V0  
123620406080100120140160180200220
 
100200
UniProt
P0A7V0
Chains
Domains
Flexibility predictions
Early folding residue predictions
Molecule details ›

Search similar proteins

Small ribosomal subunit protein uS3
Chain: AC
Length: 206 amino acids
Theoretical weight: 23.08 KDa
Source organism: Escherichia coli
UniProt:
  • Canonical: P0A7V3 (Residues: 2-207; Coverage: 88%)
Gene names: JW3276, b3314, rpsC
Pfam:
InterPro:
Small ribosomal subunit protein uS3 in PDB entry 4v4w, assembly 1, front view.
Small ribosomal subunit protein uS3 in PDB entry 4v4w, assembly 1, side view.
Small ribosomal subunit protein uS3 in PDB entry 4v4w, assembly 1, top view.
PDBe-KB: UniProt Coverage View: P0A7V3  
120620406080100120140160180200
 
50100150200
UniProt
P0A7V3
Chains
Domains
Flexibility predictions
Early folding residue predictions
Interaction interfaces
Molecule details ›

Search similar proteins

Small ribosomal subunit protein uS4
Chain: AD
Length: 204 amino acids
Theoretical weight: 23.31 KDa
Source organism: Escherichia coli
UniProt:
  • Canonical: P0A7V8 (Residues: 3-206; Coverage: 99%)
Gene names: JW3258, b3296, ramA, rpsD
Pfam:
InterPro:
Small ribosomal subunit protein uS4 in PDB entry 4v4w, assembly 1, front view.
Small ribosomal subunit protein uS4 in PDB entry 4v4w, assembly 1, side view.
Small ribosomal subunit protein uS4 in PDB entry 4v4w, assembly 1, top view.
PDBe-KB: UniProt Coverage View: P0A7V8  
120420406080100120140160180200
 
50100150200
UniProt
P0A7V8
Chains
Domains
Flexibility predictions
Early folding residue predictions
Interaction interfaces
Molecule details ›

Search similar proteins

Small ribosomal subunit protein uS5
Chain: AE
Length: 148 amino acids
Theoretical weight: 15.62 KDa
Source organism: Escherichia coli
UniProt:
  • Canonical: P0A7W1 (Residues: 10-157; Coverage: 89%)
Gene names: JW3265, b3303, rpsE, spc
Pfam:
InterPro:
Small ribosomal subunit protein uS5 in PDB entry 4v4w, assembly 1, front view.
Small ribosomal subunit protein uS5 in PDB entry 4v4w, assembly 1, side view.
Small ribosomal subunit protein uS5 in PDB entry 4v4w, assembly 1, top view.
PDBe-KB: UniProt Coverage View: P0A7W1  
114820406080100120140
 
50100
UniProt
P0A7W1
Chains
Domains
Flexibility predictions
Early folding residue predictions
Interaction interfaces
Molecule details ›

Search similar proteins

Small ribosomal subunit protein bS6, non-modified isoform
Chain: AF
Length: 95 amino acids
Theoretical weight: 11.18 KDa
Source organism: Escherichia coli
UniProt:
  • Canonical: P02358 (Residues: 1-95; Coverage: 70%)
Gene names: JW4158, b4200, rpsF
Pfam: Ribosomal protein S6
InterPro:
Small ribosomal subunit protein bS6, non-modified isoform in PDB entry 4v4w, assembly 1, front view.
Small ribosomal subunit protein bS6, non-modified isoform in PDB entry 4v4w, assembly 1, side view.
Small ribosomal subunit protein bS6, non-modified isoform in PDB entry 4v4w, assembly 1, top view.
PDBe-KB: UniProt Coverage View: P02358  
195102030405060708090
 
50MRHYEIVFMVHPDQSEQVPGMIERYTAAITGAEGKIHRLEDWGRRQLAYPINKLHKAHYVLMNVEAPQEVIDELETTFRFNDAVIRSMVMRTKHA
UniProt
P02358
Chains
Domains
Flexibility predictions
Early folding residue predictions
Interaction interfaces
Molecule details ›

Search similar proteins

Small ribosomal subunit protein uS7
Chain: AG
Length: 137 amino acids
Theoretical weight: 15.38 KDa
Source organism: Escherichia coli
UniProt:
  • Canonical: P02359 (Residues: 20-156; Coverage: 77%)
Gene names: JW3303, b3341, rpsG
Pfam: Ribosomal protein S7p/S5e
InterPro:
Small ribosomal subunit protein uS7 in PDB entry 4v4w, assembly 1, front view.
Small ribosomal subunit protein uS7 in PDB entry 4v4w, assembly 1, side view.
Small ribosomal subunit protein uS7 in PDB entry 4v4w, assembly 1, top view.
PDBe-KB: UniProt Coverage View: P02359  
1137102030405060708090100110120130
 
50100
UniProt
P02359
Chains
Domains
Flexibility predictions
Early folding residue predictions
Interaction interfaces
Molecule details ›

Search similar proteins

Small ribosomal subunit protein uS8
Chain: AH
Length: 127 amino acids
Theoretical weight: 13.86 KDa
Source organism: Escherichia coli
UniProt:
  • Canonical: P0A7W7 (Residues: 3-129; Coverage: 98%)
Gene names: JW3268, b3306, rpsH
Pfam: Ribosomal protein S8
InterPro:
Small ribosomal subunit protein uS8 in PDB entry 4v4w, assembly 1, front view.
Small ribosomal subunit protein uS8 in PDB entry 4v4w, assembly 1, side view.
Small ribosomal subunit protein uS8 in PDB entry 4v4w, assembly 1, top view.
PDBe-KB: UniProt Coverage View: P0A7W7  
Loading Protvista...
Molecule details ›

Search similar proteins

Small ribosomal subunit protein uS9
Chain: AI
Length: 126 amino acids
Theoretical weight: 14.44 KDa
Source organism: Escherichia coli
UniProt:
  • Canonical: P0A7X3 (Residues: 5-130; Coverage: 97%)
Gene names: JW3199, b3230, rpsI
Pfam: Ribosomal protein S9/S16
InterPro:
Small ribosomal subunit protein uS9 in PDB entry 4v4w, assembly 1, front view.
Small ribosomal subunit protein uS9 in PDB entry 4v4w, assembly 1, side view.
Small ribosomal subunit protein uS9 in PDB entry 4v4w, assembly 1, top view.
PDBe-KB: UniProt Coverage View: P0A7X3  
Loading Protvista...
Molecule details ›

Search similar proteins

Small ribosomal subunit protein uS10
Chain: AJ
Length: 96 amino acids
Theoretical weight: 11 KDa
Source organism: Escherichia coli
UniProt:
  • Canonical: P0A7R5 (Residues: 5-100; Coverage: 93%)
Gene names: JW3283, b3321, nusE, rpsJ
Pfam: Ribosomal protein S10p/S20e
InterPro:
Small ribosomal subunit protein uS10 in PDB entry 4v4w, assembly 1, front view.
Small ribosomal subunit protein uS10 in PDB entry 4v4w, assembly 1, side view.
Small ribosomal subunit protein uS10 in PDB entry 4v4w, assembly 1, top view.
PDBe-KB: UniProt Coverage View: P0A7R5  
Loading Protvista...
Molecule details ›

Search similar proteins

Small ribosomal subunit protein uS11
Chain: AK
Length: 116 amino acids
Theoretical weight: 12.39 KDa
Source organism: Escherichia coli
UniProt:
  • Canonical: P0A7R9 (Residues: 13-128; Coverage: 90%)
Gene names: JW3259, b3297, rpsK
Pfam: Ribosomal protein S11
InterPro:
Small ribosomal subunit protein uS11 in PDB entry 4v4w, assembly 1, front view.
Small ribosomal subunit protein uS11 in PDB entry 4v4w, assembly 1, side view.
Small ribosomal subunit protein uS11 in PDB entry 4v4w, assembly 1, top view.
PDBe-KB: UniProt Coverage View: P0A7R9  
Loading Protvista...
Molecule details ›

Search similar proteins

Small ribosomal subunit protein uS12
Chain: AL
Length: 101 amino acids
Theoretical weight: 11.25 KDa
Source organism: Escherichia coli
UniProt:
  • Canonical: P0A7S3 (Residues: 23-123; Coverage: 82%)
Gene names: JW3304, b3342, rpsL, strA
Pfam: Ribosomal protein S12/S23
InterPro:
Small ribosomal subunit protein uS12 in PDB entry 4v4w, assembly 1, front view.
Small ribosomal subunit protein uS12 in PDB entry 4v4w, assembly 1, side view.
Small ribosomal subunit protein uS12 in PDB entry 4v4w, assembly 1, top view.
PDBe-KB: UniProt Coverage View: P0A7S3  
Loading Protvista...
Molecule details ›

Search similar proteins

Small ribosomal subunit protein uS13
Chain: AM
Length: 115 amino acids
Theoretical weight: 12.74 KDa
Source organism: Escherichia coli
UniProt:
  • Canonical: P0A7S9 (Residues: 2-116; Coverage: 98%)
Gene names: JW3260, b3298, rpsM
Pfam: Ribosomal protein S13/S18
InterPro:
Small ribosomal subunit protein uS13 in PDB entry 4v4w, assembly 1, front view.
Small ribosomal subunit protein uS13 in PDB entry 4v4w, assembly 1, side view.
Small ribosomal subunit protein uS13 in PDB entry 4v4w, assembly 1, top view.
PDBe-KB: UniProt Coverage View: P0A7S9  
Loading Protvista...
Molecule details ›

Search similar proteins

Small ribosomal subunit protein uS14
Chain: AN
Length: 61 amino acids
Theoretical weight: 7.12 KDa
Source organism: Escherichia coli
UniProt:
  • Canonical: P0AG59 (Residues: 41-101; Coverage: 60%)
Gene names: JW3269, b3307, rpsN
Pfam: Ribosomal protein S14p/S29e
InterPro:
Small ribosomal subunit protein uS14 in PDB entry 4v4w, assembly 1, front view.
Small ribosomal subunit protein uS14 in PDB entry 4v4w, assembly 1, side view.
Small ribosomal subunit protein uS14 in PDB entry 4v4w, assembly 1, top view.
PDBe-KB: UniProt Coverage View: P0AG59  
Loading Protvista...
Molecule details ›

Search similar proteins

Small ribosomal subunit protein uS15
Chain: AO
Length: 86 amino acids
Theoretical weight: 9.92 KDa
Source organism: Escherichia coli
UniProt:
  • Canonical: P0ADZ4 (Residues: 3-88; Coverage: 97%)
Gene names: JW3134, b3165, rpsO, secC
Pfam: Ribosomal protein S15
InterPro:
Small ribosomal subunit protein uS15 in PDB entry 4v4w, assembly 1, front view.
Small ribosomal subunit protein uS15 in PDB entry 4v4w, assembly 1, side view.
Small ribosomal subunit protein uS15 in PDB entry 4v4w, assembly 1, top view.
PDBe-KB: UniProt Coverage View: P0ADZ4  
Loading Protvista...
Molecule details ›

Search similar proteins

Small ribosomal subunit protein bS16
Chain: AP
Length: 78 amino acids
Theoretical weight: 8.82 KDa
Source organism: Escherichia coli
UniProt:
  • Canonical: P0A7T3 (Residues: 1-78; Coverage: 95%)
Gene names: JW2590, b2609, rpsP
Pfam: Ribosomal protein S16
InterPro:
Small ribosomal subunit protein bS16 in PDB entry 4v4w, assembly 1, front view.
Small ribosomal subunit protein bS16 in PDB entry 4v4w, assembly 1, side view.
Small ribosomal subunit protein bS16 in PDB entry 4v4w, assembly 1, top view.
PDBe-KB: UniProt Coverage View: P0A7T3  
Loading Protvista...
Molecule details ›

Search similar proteins

Small ribosomal subunit protein uS17
Chain: AQ
Length: 79 amino acids
Theoretical weight: 9.13 KDa
Source organism: Escherichia coli
UniProt:
  • Canonical: P0AG63 (Residues: 6-84; Coverage: 94%)
Gene names: JW3273, b3311, neaA, rpsQ
Pfam: Ribosomal protein S17
InterPro:
Small ribosomal subunit protein uS17 in PDB entry 4v4w, assembly 1, front view.
Small ribosomal subunit protein uS17 in PDB entry 4v4w, assembly 1, side view.
Small ribosomal subunit protein uS17 in PDB entry 4v4w, assembly 1, top view.
PDBe-KB: UniProt Coverage View: P0AG63  
Loading Protvista...
Molecule details ›

Search similar proteins

Small ribosomal subunit protein bS18
Chain: AR
Length: 69 amino acids
Theoretical weight: 8.18 KDa
Source organism: Escherichia coli
UniProt:
  • Canonical: P0A7T7 (Residues: 7-75; Coverage: 92%)
Gene names: JW4160, b4202, rpsR
Pfam: Ribosomal protein S18
InterPro:
Small ribosomal subunit protein bS18 in PDB entry 4v4w, assembly 1, front view.
Small ribosomal subunit protein bS18 in PDB entry 4v4w, assembly 1, side view.
Small ribosomal subunit protein bS18 in PDB entry 4v4w, assembly 1, top view.
PDBe-KB: UniProt Coverage View: P0A7T7  
Loading Protvista...
Molecule details ›

Search similar proteins

Small ribosomal subunit protein uS19
Chain: AS
Length: 87 amino acids
Theoretical weight: 9.87 KDa
Source organism: Escherichia coli
UniProt:
  • Canonical: P0A7U3 (Residues: 2-88; Coverage: 95%)
Gene names: JW3278, b3316, rpsS
Pfam: Ribosomal protein S19
InterPro:
Small ribosomal subunit protein uS19 in PDB entry 4v4w, assembly 1, front view.
Small ribosomal subunit protein uS19 in PDB entry 4v4w, assembly 1, side view.
Small ribosomal subunit protein uS19 in PDB entry 4v4w, assembly 1, top view.
PDBe-KB: UniProt Coverage View: P0A7U3  
Loading Protvista...
Molecule details ›

Search similar proteins

Small ribosomal subunit protein bS20
Chain: AT
Length: 83 amino acids
Theoretical weight: 9.28 KDa
Source organism: Escherichia coli
UniProt:
  • Canonical: P0A7U7 (Residues: 5-87; Coverage: 95%)
Gene names: JW0022, b0023, rpsT
Pfam: Ribosomal protein S20
InterPro:
Small ribosomal subunit protein bS20 in PDB entry 4v4w, assembly 1, front view.
Small ribosomal subunit protein bS20 in PDB entry 4v4w, assembly 1, side view.
Small ribosomal subunit protein bS20 in PDB entry 4v4w, assembly 1, top view.
PDBe-KB: UniProt Coverage View: P0A7U7  
Loading Protvista...
Molecule details ›

Search similar proteins

Large ribosomal subunit protein uL1
Chain: B2
Length: 222 amino acids
Theoretical weight: 23.59 KDa
Source organism: Escherichia coli
UniProt:
  • Canonical: P0A7L0 (Residues: 6-227; Coverage: 95%)
Gene names: JW3947, b3984, rplA
Pfam: Ribosomal protein L1p/L10e family
InterPro:
Large ribosomal subunit protein uL1 in PDB entry 4v4w, assembly 1, front view.
Large ribosomal subunit protein uL1 in PDB entry 4v4w, assembly 1, side view.
Large ribosomal subunit protein uL1 in PDB entry 4v4w, assembly 1, top view.
PDBe-KB: UniProt Coverage View: P0A7L0  
Loading Protvista...
Molecule details ›

Search similar proteins

Large ribosomal subunit protein bL12
Chains: B3, B5
Length: 119 amino acids
Theoretical weight: 12.09 KDa
Source organism: Escherichia coli
UniProt:
  • Canonical: P0A7K2 (Residues: 3-121; Coverage: 98%)
Gene names: JW3949, b3986, rplL
Pfam:
InterPro:
Large ribosomal subunit protein bL12 in PDB entry 4v4w, assembly 1, front view.
Large ribosomal subunit protein bL12 in PDB entry 4v4w, assembly 1, side view.
Large ribosomal subunit protein bL12 in PDB entry 4v4w, assembly 1, top view.
PDBe-KB: UniProt Coverage View: P0A7K2  
Loading Protvista...
Molecule details ›

Search similar proteins

Large ribosomal subunit protein uL2
Chain: BA
Length: 227 amino acids
Theoretical weight: 24.69 KDa
Source organism: Escherichia coli
UniProt:
  • Canonical: P60422 (Residues: 39-265; Coverage: 83%)
Gene names: JW3279, b3317, rplB
Pfam:
InterPro:
Large ribosomal subunit protein uL2 in PDB entry 4v4w, assembly 1, front view.
Large ribosomal subunit protein uL2 in PDB entry 4v4w, assembly 1, side view.
Large ribosomal subunit protein uL2 in PDB entry 4v4w, assembly 1, top view.
PDBe-KB: UniProt Coverage View: P60422  
Loading Protvista...
Molecule details ›

Search similar proteins

Large ribosomal subunit protein uL3
Chain: BB
Length: 209 amino acids
Theoretical weight: 22.28 KDa
Source organism: Escherichia coli
UniProt:
  • Canonical: P60438 (Residues: 1-209; Coverage: 100%)
Gene names: JW3282, b3320, rplC
Pfam: Ribosomal protein L3
InterPro:
Large ribosomal subunit protein uL3 in PDB entry 4v4w, assembly 1, front view.
Large ribosomal subunit protein uL3 in PDB entry 4v4w, assembly 1, side view.
Large ribosomal subunit protein uL3 in PDB entry 4v4w, assembly 1, top view.
PDBe-KB: UniProt Coverage View: P60438  
Loading Protvista...
Molecule details ›

Search similar proteins

Large ribosomal subunit protein uL4
Chain: BC
Length: 198 amino acids
Theoretical weight: 21.81 KDa
Source organism: Escherichia coli
UniProt:
  • Canonical: P60723 (Residues: 1-198; Coverage: 99%)
Gene names: JW3281, b3319, eryA, rplD
Pfam: Ribosomal protein L4/L1 family
InterPro:
Large ribosomal subunit protein uL4 in PDB entry 4v4w, assembly 1, front view.
Large ribosomal subunit protein uL4 in PDB entry 4v4w, assembly 1, side view.
Large ribosomal subunit protein uL4 in PDB entry 4v4w, assembly 1, top view.
PDBe-KB: UniProt Coverage View: P60723  
Loading Protvista...
Molecule details ›

Search similar proteins

Large ribosomal subunit protein uL5
Chain: BD
Length: 177 amino acids
Theoretical weight: 20.13 KDa
Source organism: Escherichia coli
UniProt:
  • Canonical: P62399 (Residues: 3-179; Coverage: 99%)
Gene names: JW3270, b3308, rplE
Pfam:
InterPro:
Large ribosomal subunit protein uL5 in PDB entry 4v4w, assembly 1, front view.
Large ribosomal subunit protein uL5 in PDB entry 4v4w, assembly 1, side view.
Large ribosomal subunit protein uL5 in PDB entry 4v4w, assembly 1, top view.
PDBe-KB: UniProt Coverage View: P62399  
Loading Protvista...
Molecule details ›

Search similar proteins

Large ribosomal subunit protein uL6
Chain: BE
Length: 167 amino acids
Theoretical weight: 17.8 KDa
Source organism: Escherichia coli
UniProt:
  • Canonical: P0AG55 (Residues: 6-172; Coverage: 94%)
Gene names: JW3267, b3305, rplF
Pfam: Ribosomal protein L6
InterPro:
Large ribosomal subunit protein uL6 in PDB entry 4v4w, assembly 1, front view.
Large ribosomal subunit protein uL6 in PDB entry 4v4w, assembly 1, side view.
Large ribosomal subunit protein uL6 in PDB entry 4v4w, assembly 1, top view.
PDBe-KB: UniProt Coverage View: P0AG55  
Loading Protvista...
Molecule details ›

Search similar proteins

Large ribosomal subunit protein bL9
Chain: BF
Length: 149 amino acids
Theoretical weight: 15.79 KDa
Source organism: Escherichia coli
UniProt:
  • Canonical: P0A7R1 (Residues: 1-149; Coverage: 100%)
Gene names: JW4161, b4203, rplI
Pfam:
InterPro:
Large ribosomal subunit protein bL9 in PDB entry 4v4w, assembly 1, front view.
Large ribosomal subunit protein bL9 in PDB entry 4v4w, assembly 1, side view.
Large ribosomal subunit protein bL9 in PDB entry 4v4w, assembly 1, top view.
PDBe-KB: UniProt Coverage View: P0A7R1  
Loading Protvista...
Molecule details ›

Search similar proteins

Large ribosomal subunit protein uL11
Chain: BG
Length: 139 amino acids
Theoretical weight: 14.58 KDa
Source organism: Escherichia coli
UniProt:
  • Canonical: P0A7J7 (Residues: 3-141; Coverage: 98%)
Gene names: JW3946, b3983, relC, rplK
Pfam:
InterPro:
Large ribosomal subunit protein uL11 in PDB entry 4v4w, assembly 1, front view.
Large ribosomal subunit protein uL11 in PDB entry 4v4w, assembly 1, side view.
Large ribosomal subunit protein uL11 in PDB entry 4v4w, assembly 1, top view.
PDBe-KB: UniProt Coverage View: P0A7J7  
Loading Protvista...
Molecule details ›

Search similar proteins

Large ribosomal subunit protein uL13
Chain: BH
Length: 142 amino acids
Theoretical weight: 16.05 KDa
Source organism: Escherichia coli
UniProt:
  • Canonical: P0AA10 (Residues: 1-142; Coverage: 100%)
Gene names: JW3200, b3231, rplM
Pfam: Ribosomal protein L13
InterPro:
Large ribosomal subunit protein uL13 in PDB entry 4v4w, assembly 1, front view.
Large ribosomal subunit protein uL13 in PDB entry 4v4w, assembly 1, side view.
Large ribosomal subunit protein uL13 in PDB entry 4v4w, assembly 1, top view.
PDBe-KB: UniProt Coverage View: P0AA10  
Loading Protvista...
Molecule details ›

Search similar proteins

Large ribosomal subunit protein uL14
Chain: BI
Length: 122 amino acids
Theoretical weight: 13.43 KDa
Source organism: Escherichia coli
UniProt:
  • Canonical: P0ADY3 (Residues: 2-123; Coverage: 99%)
Gene names: JW3272, b3310, rplN
Pfam: Ribosomal protein L14p/L23e
InterPro:
Large ribosomal subunit protein uL14 in PDB entry 4v4w, assembly 1, front view.
Large ribosomal subunit protein uL14 in PDB entry 4v4w, assembly 1, side view.
Large ribosomal subunit protein uL14 in PDB entry 4v4w, assembly 1, top view.
PDBe-KB: UniProt Coverage View: P0ADY3  
Loading Protvista...
Molecule details ›

Search similar proteins

Large ribosomal subunit protein uL15
Chain: BJ
Length: 140 amino acids
Theoretical weight: 14.48 KDa
Source organism: Escherichia coli
UniProt:
  • Canonical: P02413 (Residues: 4-143; Coverage: 97%)
Gene names: JW3263, b3301, rplO
Pfam: Ribosomal proteins 50S-L15, 50S-L18e, 60S-L27A
InterPro:
Large ribosomal subunit protein uL15 in PDB entry 4v4w, assembly 1, front view.
Large ribosomal subunit protein uL15 in PDB entry 4v4w, assembly 1, side view.
Large ribosomal subunit protein uL15 in PDB entry 4v4w, assembly 1, top view.
PDBe-KB: UniProt Coverage View: P02413  
Loading Protvista...
Molecule details ›

Search similar proteins

Large ribosomal subunit protein uL16
Chain: BK
Length: 131 amino acids
Theoretical weight: 14.74 KDa
Source organism: Escherichia coli
UniProt:
  • Canonical: P0ADY7 (Residues: 3-133; Coverage: 96%)
Gene names: JW3275, b3313, rplP
Pfam: Ribosomal protein L16p/L10e
InterPro:
Large ribosomal subunit protein uL16 in PDB entry 4v4w, assembly 1, front view.
Large ribosomal subunit protein uL16 in PDB entry 4v4w, assembly 1, side view.
Large ribosomal subunit protein uL16 in PDB entry 4v4w, assembly 1, top view.
PDBe-KB: UniProt Coverage View: P0ADY7  
Loading Protvista...
Molecule details ›

Search similar proteins

Large ribosomal subunit protein bL17
Chain: BL
Length: 114 amino acids
Theoretical weight: 12.95 KDa
Source organism: Escherichia coli
UniProt:
  • Canonical: P0AG44 (Residues: 3-116; Coverage: 90%)
Gene names: JW3256, b3294, rplQ
Pfam: Ribosomal protein L17
InterPro:
Large ribosomal subunit protein bL17 in PDB entry 4v4w, assembly 1, front view.
Large ribosomal subunit protein bL17 in PDB entry 4v4w, assembly 1, side view.
Large ribosomal subunit protein bL17 in PDB entry 4v4w, assembly 1, top view.
PDBe-KB: UniProt Coverage View: P0AG44  
Loading Protvista...
Molecule details ›

Search similar proteins

Large ribosomal subunit protein uL18
Chain: BM
Length: 113 amino acids
Theoretical weight: 12.27 KDa
Source organism: Escherichia coli
UniProt:
  • Canonical: P0C018 (Residues: 3-115; Coverage: 97%)
Gene names: JW3266, b3304, rplR
Pfam: Ribosomal L18 of archaea, bacteria, mitoch. and chloroplast
InterPro:
Large ribosomal subunit protein uL18 in PDB entry 4v4w, assembly 1, front view.
Large ribosomal subunit protein uL18 in PDB entry 4v4w, assembly 1, side view.
Large ribosomal subunit protein uL18 in PDB entry 4v4w, assembly 1, top view.
PDBe-KB: UniProt Coverage View: P0C018  
Loading Protvista...
Molecule details ›

Search similar proteins

Large ribosomal subunit protein bL19
Chain: BN
Length: 114 amino acids
Theoretical weight: 13.03 KDa
Source organism: Escherichia coli
UniProt:
  • Canonical: P0A7K6 (Residues: 2-115; Coverage: 99%)
Gene names: JW2587, b2606, rplS
Pfam: Ribosomal protein L19
InterPro:
Large ribosomal subunit protein bL19 in PDB entry 4v4w, assembly 1, front view.
Large ribosomal subunit protein bL19 in PDB entry 4v4w, assembly 1, side view.
Large ribosomal subunit protein bL19 in PDB entry 4v4w, assembly 1, top view.
PDBe-KB: UniProt Coverage View: P0A7K6  
Loading Protvista...
Molecule details ›

Search similar proteins

Large ribosomal subunit protein bL20
Chain: BO
Length: 115 amino acids
Theoretical weight: 13.25 KDa
Source organism: Escherichia coli
UniProt:
  • Canonical: P0A7L3 (Residues: 3-117; Coverage: 98%)
Gene names: JW1706, b1716, pdzA, rplT
Pfam: Ribosomal protein L20
InterPro:
Large ribosomal subunit protein bL20 in PDB entry 4v4w, assembly 1, front view.
Large ribosomal subunit protein bL20 in PDB entry 4v4w, assembly 1, side view.
Large ribosomal subunit protein bL20 in PDB entry 4v4w, assembly 1, top view.
PDBe-KB: UniProt Coverage View: P0A7L3  
Loading Protvista...
Molecule details ›

Search similar proteins

Large ribosomal subunit protein uL22
Chain: BQ
Length: 106 amino acids
Theoretical weight: 11.78 KDa
Source organism: Escherichia coli
UniProt:
  • Canonical: P61175 (Residues: 5-110; Coverage: 96%)
Gene names: JW3277, b3315, eryB, rplV
Pfam: Ribosomal protein L22p/L17e
InterPro:
Large ribosomal subunit protein uL22 in PDB entry 4v4w, assembly 1, front view.
Large ribosomal subunit protein uL22 in PDB entry 4v4w, assembly 1, side view.
Large ribosomal subunit protein uL22 in PDB entry 4v4w, assembly 1, top view.
PDBe-KB: UniProt Coverage View: P61175  
Loading Protvista...
Molecule details ›

Search similar proteins

Large ribosomal subunit protein uL23
Chain: BR
Length: 92 amino acids
Theoretical weight: 10.21 KDa
Source organism: Escherichia coli
UniProt:
  • Canonical: P0ADZ0 (Residues: 7-98; Coverage: 92%)
Gene names: JW3280, b3318, rplW
Pfam: Ribosomal protein L23
InterPro:
Large ribosomal subunit protein uL23 in PDB entry 4v4w, assembly 1, front view.
Large ribosomal subunit protein uL23 in PDB entry 4v4w, assembly 1, side view.
Large ribosomal subunit protein uL23 in PDB entry 4v4w, assembly 1, top view.
PDBe-KB: UniProt Coverage View: P0ADZ0  
Loading Protvista...
Molecule details ›

Search similar proteins

Large ribosomal subunit protein uL24
Chain: BS
Length: 99 amino acids
Theoretical weight: 10.82 KDa
Source organism: Escherichia coli
UniProt:
  • Canonical: P60624 (Residues: 4-102; Coverage: 95%)
Gene names: JW3271, b3309, rplX
Pfam:
InterPro:
Large ribosomal subunit protein uL24 in PDB entry 4v4w, assembly 1, front view.
Large ribosomal subunit protein uL24 in PDB entry 4v4w, assembly 1, side view.
Large ribosomal subunit protein uL24 in PDB entry 4v4w, assembly 1, top view.
PDBe-KB: UniProt Coverage View: P60624  
Loading Protvista...
Molecule details ›

Search similar proteins

Large ribosomal subunit protein bL25
Chain: BT
Length: 94 amino acids
Theoretical weight: 10.71 KDa
Source organism: Escherichia coli
UniProt:
  • Canonical: P68919 (Residues: 1-94; Coverage: 100%)
Gene names: JW2173, b2185, rplY
Pfam: Ribosomal L25p family
InterPro:
Large ribosomal subunit protein bL25 in PDB entry 4v4w, assembly 1, front view.
Large ribosomal subunit protein bL25 in PDB entry 4v4w, assembly 1, side view.
Large ribosomal subunit protein bL25 in PDB entry 4v4w, assembly 1, top view.
PDBe-KB: UniProt Coverage View: P68919  
Loading Protvista...
Molecule details ›

Search similar proteins

Large ribosomal subunit protein bL27
Chain: BU
Length: 84 amino acids
Theoretical weight: 9.02 KDa
Source organism: Escherichia coli
UniProt:
  • Canonical: P0A7L8 (Residues: 2-85; Coverage: 99%)
Gene names: JW3152, b3185, rpmA
Pfam: Ribosomal L27 protein
InterPro:
Large ribosomal subunit protein bL27 in PDB entry 4v4w, assembly 1, front view.
Large ribosomal subunit protein bL27 in PDB entry 4v4w, assembly 1, side view.
Large ribosomal subunit protein bL27 in PDB entry 4v4w, assembly 1, top view.
PDBe-KB: UniProt Coverage View: P0A7L8  
Loading Protvista...
Molecule details ›

Search similar proteins

Large ribosomal subunit protein uL29
Chain: BW
Length: 60 amino acids
Theoretical weight: 7.09 KDa
Source organism: Escherichia coli
UniProt:
  • Canonical: P0A7M6 (Residues: 1-60; Coverage: 95%)
Gene names: JW3274, b3312, rpmC
Pfam: Ribosomal L29 protein
InterPro:
Large ribosomal subunit protein uL29 in PDB entry 4v4w, assembly 1, front view.
Large ribosomal subunit protein uL29 in PDB entry 4v4w, assembly 1, side view.
Large ribosomal subunit protein uL29 in PDB entry 4v4w, assembly 1, top view.
PDBe-KB: UniProt Coverage View: P0A7M6  
Loading Protvista...
Molecule details ›

Search similar proteins

Large ribosomal subunit protein uL30
Chain: BX
Length: 56 amino acids
Theoretical weight: 6.22 KDa
Source organism: Escherichia coli
UniProt:
  • Canonical: P0AG51 (Residues: 4-59; Coverage: 95%)
Gene names: JW3264, b3302, rpmD
Pfam: Ribosomal protein L30p/L7e
InterPro:
Large ribosomal subunit protein uL30 in PDB entry 4v4w, assembly 1, front view.
Large ribosomal subunit protein uL30 in PDB entry 4v4w, assembly 1, side view.
Large ribosomal subunit protein uL30 in PDB entry 4v4w, assembly 1, top view.
PDBe-KB: UniProt Coverage View: P0AG51  
Loading Protvista...
Molecule details ›

Search similar proteins

Large ribosomal subunit protein bL32
Chain: BZ
Length: 29 amino acids
Theoretical weight: 3.32 KDa
Source organism: Escherichia coli
UniProt:
  • Canonical: P0A7N4 (Residues: 28-56; Coverage: 51%)
Gene names: JW1075, b1089, rpmF
Pfam: Ribosomal L32p protein family
InterPro:
Large ribosomal subunit protein bL32 in PDB entry 4v4w, assembly 1, front view.
Large ribosomal subunit protein bL32 in PDB entry 4v4w, assembly 1, side view.
Large ribosomal subunit protein bL32 in PDB entry 4v4w, assembly 1, top view.
PDBe-KB: UniProt Coverage View: P0A7N4  
Loading Protvista...
Molecule details ›

Search similar proteins

Large ribosomal subunit protein bL33
Chain: B1
Length: 52 amino acids
Theoretical weight: 6.02 KDa
Source organism: Escherichia coli
UniProt:
  • Canonical: P0A7N9 (Residues: 2-53; Coverage: 95%)
Gene names: JW3611, b3636, rpmG
Pfam: Ribosomal protein L33
InterPro:
Large ribosomal subunit protein bL33 in PDB entry 4v4w, assembly 1, front view.
Large ribosomal subunit protein bL33 in PDB entry 4v4w, assembly 1, side view.
Large ribosomal subunit protein bL33 in PDB entry 4v4w, assembly 1, top view.
PDBe-KB: UniProt Coverage View: P0A7N9  
Loading Protvista...
Molecule details ›

Search similar proteins

RNA chain AA
Name: 16S ribosomal RNA
Representative chains: AA
Length: 1488 nucleotides
Theoretical weight: 482.29 KDa
Rfam: Bacterial small subunit ribosomal RNA
16S ribosomal RNA in PDB entry 4v4w, assembly 1, front view.
16S ribosomal RNA in PDB entry 4v4w, assembly 1, side view.
16S ribosomal RNA in PDB entry 4v4w, assembly 1, top view.
Loading Protvista...
Molecule details ›

Search similar RNA

RNA chains AU, AV, AW
Name: tRNA
Representative chains: AU, AV, AW
Length: 76 nucleotides
Theoretical weight: 24.52 KDa
Rfam: tRNA
tRNA in PDB entry 4v4w, assembly 1, front view.
tRNA in PDB entry 4v4w, assembly 1, side view.
tRNA in PDB entry 4v4w, assembly 1, top view.
Loading Protvista...
Molecule details ›

Search similar RNA

RNA chain B0
Name: 23S ribosomal RNA
Representative chains: B0
Length: 2740 nucleotides
Theoretical weight: 888.5 KDa
Rfam: Bacterial large subunit ribosomal RNA
23S ribosomal RNA in PDB entry 4v4w, assembly 1, front view.
23S ribosomal RNA in PDB entry 4v4w, assembly 1, side view.
23S ribosomal RNA in PDB entry 4v4w, assembly 1, top view.
Loading Protvista...
Molecule details ›

Search similar RNA

RNA chain B9
Name: 5S ribosomal RNA
Representative chains: B9
Length: 108 nucleotides
Theoretical weight: 34.92 KDa
Rfam: 5S ribosomal RNA
5S ribosomal RNA in PDB entry 4v4w, assembly 1, front view.
5S ribosomal RNA in PDB entry 4v4w, assembly 1, side view.
5S ribosomal RNA in PDB entry 4v4w, assembly 1, top view.
Loading Protvista...
Molecule details ›

Search similar RNA

Quick links