› › Structure analysis

Solution NMR structure of cyclotide MCoTI-I

Solution NMR
PDB entry 5wov coloured by chain, ensemble of 20 models, front view.
PDB entry 5wov coloured by chain, ensemble of 20 models, side view.
PDB entry 5wov coloured by chain, ensemble of 20 models, top view.
Source organism: Momordica cochinchinensis
Assembly composition:
monomeric (preferred)
Entry contents: 1 distinct polypeptide molecule

Quick links

Assemblies

Assembly 1 (preferred)
Download    3D Visualisation
Assembly Name: Two inhibitor peptide topologies 2
hide full assembly name
Multimeric state: monomeric
Accessible surface area: 2462.37 Å2
Buried surface area: 0.0 Å2
Dissociation area: 0 Å2
Dissociation energy (ΔGdiss): 0 kcal/mol
Dissociation entropy (TΔSdiss): 0 kcal/mol
Symmetry number: 1
PDBe Complex ID: PDB-CPX-166288

Macromolecules

Two inhibitor peptide topologies 2
Chain: A
Length: 34 amino acids
Theoretical weight: 3.51 KDa
Source organism: Momordica cochinchinensis
Expression system: Not provided
InterPro:
Two inhibitor peptide topologies 2 in PDB entry 5wov, assembly 1, front view.
Two inhibitor peptide topologies 2 in PDB entry 5wov, assembly 1, side view.
Two inhibitor peptide topologies 2 in PDB entry 5wov, assembly 1, top view.
13451015202530
 
102030GGVCPKILQRCRRDSDCPGACICRGNGYCGSGSD
Chains
Chain A (auth A)
Domains
Secondary structure
Flexibility predictions
Molecule details ›

Search similar proteins

Quick links