› › Small nuclear ribonucleoprotein-associated proteins B and B'

Small nuclear ribonucleoprotein-associated proteins B and B' in PDB entry 7abi, assembly 1, front view.
Small nuclear ribonucleoprotein-associated proteins B and B' in PDB entry 7abi, assembly 1, side view.
Small nuclear ribonucleoprotein-associated proteins B and B' in PDB entry 7abi, assembly 1, top view.
Chains: f, m
Length: 240 amino acids
Theoretical weight: 24.64 KDa
Source organism: Homo sapiens
UniProt:
  • Canonical: P14678 (Residues: 1-240; Coverage: 100%)
Gene names: COD, SNRPB, SNRPB1
FASTA Sequence
>pdb|7abi|f m
MTVGKSSKMLQHIDYRMRCILQDGRIFIGTFKAFDKHMNLILCDCDEFRKIKPKNSKQAEREEKRVLGLVLLRGENLVSMTVEGPPPKDTGIARVPLAGAAGGPGIGRAAGRGIPAGVPMPQAPAGLAGPVRGVGGPSQQVMTPQGRGTVAAAAAAATASIAGAPTQYPPGRGGPPPPMGRGAPPPGMMGPPPGMRPPMGPPMGIPPGRGTPMGMPPPGMRPPPPGMRGPPPPGMRPPRP
PDBe-KB: UniProt Coverage View: P14678  

Quick links

Search similar proteins