› › VP4 of O type FMDV capsid

VP4 of O type FMDV capsid in PDB entry 7dst, assembly 1, front view.
VP4 of O type FMDV capsid in PDB entry 7dst, assembly 1, side view.
VP4 of O type FMDV capsid in PDB entry 7dst, assembly 1, top view.
Chain: D
Length: 75 amino acids
Theoretical weight: 7.96 KDa
Source organism: Foot-and-mouth disease virus
UniProt:
  • Canonical: A0A0K0QSS3 (Residues: 212-286; Coverage: 3%)
FASTA Sequence
>pdb|7dst|D
SQNQSGNTGSIINNYYMQQYQNSMDTQLGNNAISGGSNEGSTDTTSTHTTNTQNNDWFSKLASSAFSGLFGALLA
PDBe-KB: UniProt Coverage View: A0A0K0QSS3  

Quick links

Search similar proteins