› › Structure analysis

Crystal structure of Bcl-2 in complex with prodrug ABBV-167

X-ray diffraction
2.068Å resolution
PDB entry 7lhb coloured by chain, front view.
PDB entry 7lhb coloured by chain, side view.
PDB entry 7lhb coloured by chain, top view.
Source organism: Homo sapiens
Assembly composition:
monomeric (preferred)
Entry contents: 1 distinct polypeptide molecule

Quick links

Assemblies

Assembly 1 (preferred)
Download    3D Visualisation
Assembly Name: Apoptosis regulator Bcl-2
hide full assembly name
Multimeric state: monomeric
Accessible surface area: 7588.85 Å2
Buried surface area: 0.0 Å2
Dissociation area: 0 Å2
Dissociation energy (ΔGdiss): 0 kcal/mol
Dissociation entropy (TΔSdiss): 0 kcal/mol
Symmetry number: 1
PDBe Complex ID: PDB-CPX-145305
Assembly 2
Download    3D Visualisation
Assembly Name: Apoptosis regulator Bcl-2
hide full assembly name
Multimeric state: monomeric
Accessible surface area: 7765.39 Å2
Buried surface area: 0.0 Å2
Dissociation area: 0 Å2
Dissociation energy (ΔGdiss): 0 kcal/mol
Dissociation entropy (TΔSdiss): 0 kcal/mol
Symmetry number: 1
PDBe Complex ID: PDB-CPX-145305
Assembly 3
Download    3D Visualisation
Assembly Name: Apoptosis regulator Bcl-2
hide full assembly name
Multimeric state: monomeric
Accessible surface area: 7654.32 Å2
Buried surface area: 0.0 Å2
Dissociation area: 0 Å2
Dissociation energy (ΔGdiss): 0 kcal/mol
Dissociation entropy (TΔSdiss): 0 kcal/mol
Symmetry number: 1
PDBe Complex ID: PDB-CPX-145305

Macromolecules

Apoptosis regulator Bcl-2
Chains: A, B, C
Length: 166 amino acids
Theoretical weight: 19.36 KDa
Source organism: Homo sapiens
Expression system: Escherichia coli BL21(DE3)
UniProt:
  • Canonical: P10415 (Residues: 1-207; Coverage: 70%)
Gene name: BCL2
Pfam:
InterPro:
Apoptosis regulator Bcl-2 in PDB entry 7lhb, assembly 1, front view.
Apoptosis regulator Bcl-2 in PDB entry 7lhb, assembly 1, side view.
Apoptosis regulator Bcl-2 in PDB entry 7lhb, assembly 1, top view.
PDBe-KB: UniProt Coverage View: P10415  
116620406080100120140160
 
50100150MAHPGRTGYDNREIVMKYIHYKLSQKGYEWDAGDDVEENRTEAPEGTESEVVHLTLRQAGDDFSRRYRRDFAEMSSQLHLTPFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESVNREMSPLVDNIALWMTEYLNRHLHTWIQDNGGWDAFVELYGPSMR
UniProt
P10415
Chains
Domains
Secondary structure
Flexibility predictions
Ligand binding sites
Sequence conservation
Molecule details ›

Search similar proteins

Quick links