PDBe-KB: UniProt Coverage View:
A0A8D1TL60
![NADH dehydrogenase [ubiquinone] iron-sulfur protein 7, mitochondrial in PDB entry 7vwj, assembly 1, front view.](https://www.ebi.ac.uk/pdbe/static/entry/7vwj_entity_3_front_image-200x200.png "Hetero 18-meric assembly 1 of PDB entry <span class='highlight'>7vwj</span> contains 1 copy of <span class='highlight'>NADH dehydrogenase [ubiquinone] iron-sulfur protein 7, mitochondrial</span>. Front view.")
![NADH dehydrogenase [ubiquinone] iron-sulfur protein 7, mitochondrial in PDB entry 7vwj, assembly 1, side view.](https://www.ebi.ac.uk/pdbe/static/entry/7vwj_entity_3_side_image-200x200.png "Hetero 18-meric assembly 1 of PDB entry <span class='highlight'>7vwj</span> contains 1 copy of <span class='highlight'>NADH dehydrogenase [ubiquinone] iron-sulfur protein 7, mitochondrial</span>. Side view.")
![NADH dehydrogenase [ubiquinone] iron-sulfur protein 7, mitochondrial in PDB entry 7vwj, assembly 1, top view.](https://www.ebi.ac.uk/pdbe/static/entry/7vwj_entity_3_top_image-200x200.png "Hetero 18-meric assembly 1 of PDB entry <span class='highlight'>7vwj</span> contains 1 copy of <span class='highlight'>NADH dehydrogenase [ubiquinone] iron-sulfur protein 7, mitochondrial</span>. Top view.")
Chain: C
Length: 156 amino acids
Theoretical weight: 17.87 KDa
Source organism: Sus scrofa
UniProt:
FASTA Sequence
Length: 156 amino acids
Theoretical weight: 17.87 KDa
Source organism: Sus scrofa
UniProt:
- Canonical: A0A8D1TL60 (Residues: 41-196; Coverage: 80%)
FASTA Sequence
>pdb|7vwj|C
SRGEYVVAKLDDLVNWARRSSLWPMTFGLACCAVEMMHMAAPRYDMDRFGVVFRASPRQSDVMIVAGTLTNKMAPALRKVYDQMPEPRYVVSMGSCANGGGYYHYSYSVVRGCDRIVPVDIYVPGCPPTAEALLYGILQLQRKIKREKRLRIWYRR
PDBe-KB: UniProt Coverage View:
A0A8D1TL60