PDBe-KB: UniProt Coverage View:
A0A836D7R1
![NADH dehydrogenase [ubiquinone] iron-sulfur protein 5 in PDB entry 7zeb, assembly 1, front view.](https://www.ebi.ac.uk/pdbe/static/entry/7zeb_entity_15_front_image-200x200.png "Hetero 45-meric assembly 1 of PDB entry <span class='highlight'>7zeb</span> contains 1 copy of <span class='highlight'>NADH dehydrogenase [ubiquinone] iron-sulfur protein 5</span>. Front view.")
![NADH dehydrogenase [ubiquinone] iron-sulfur protein 5 in PDB entry 7zeb, assembly 1, side view.](https://www.ebi.ac.uk/pdbe/static/entry/7zeb_entity_15_side_image-200x200.png "Hetero 45-meric assembly 1 of PDB entry <span class='highlight'>7zeb</span> contains 1 copy of <span class='highlight'>NADH dehydrogenase [ubiquinone] iron-sulfur protein 5</span>. Side view.")
![NADH dehydrogenase [ubiquinone] iron-sulfur protein 5 in PDB entry 7zeb, assembly 1, top view.](https://www.ebi.ac.uk/pdbe/static/entry/7zeb_entity_15_top_image-200x200.png "Hetero 45-meric assembly 1 of PDB entry <span class='highlight'>7zeb</span> contains 1 copy of <span class='highlight'>NADH dehydrogenase [ubiquinone] iron-sulfur protein 5</span>. Top view.")
Chain: l
Length: 105 amino acids
Theoretical weight: 12.47 KDa
Source organism: Ovis aries
UniProt:
FASTA Sequence
Length: 105 amino acids
Theoretical weight: 12.47 KDa
Source organism: Ovis aries
UniProt:
- Canonical: A0A836D7R1 (Residues: 192-296; Coverage: 36%)
FASTA Sequence
>pdb|7zeb|l
PFFDVQKKLGVDLDHWMTIQSAEQPHRIPARCHAFEKEWIECAHGIGSIRAEKECKIEFEDFRECLLRQKTMKRLNAIKRQRDKLIKEGKYTPPPHHSGQEDLRP
PDBe-KB: UniProt Coverage View:
A0A836D7R1