PDBe-KB: UniProt Coverage View:
A0A6P7DQB1
![NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 3 in PDB entry 7zeb, assembly 1, front view.](https://www.ebi.ac.uk/pdbe/static/entry/7zeb_entity_17_front_image-200x200.png "Hetero 45-meric assembly 1 of PDB entry <span class='highlight'>7zeb</span> contains 1 copy of <span class='highlight'>NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 3</span>. Front view.")
![NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 3 in PDB entry 7zeb, assembly 1, side view.](https://www.ebi.ac.uk/pdbe/static/entry/7zeb_entity_17_side_image-200x200.png "Hetero 45-meric assembly 1 of PDB entry <span class='highlight'>7zeb</span> contains 1 copy of <span class='highlight'>NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 3</span>. Side view.")
![NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 3 in PDB entry 7zeb, assembly 1, top view.](https://www.ebi.ac.uk/pdbe/static/entry/7zeb_entity_17_top_image-200x200.png "Hetero 45-meric assembly 1 of PDB entry <span class='highlight'>7zeb</span> contains 1 copy of <span class='highlight'>NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 3</span>. Top view.")
Chain: n
Length: 79 amino acids
Theoretical weight: 8.96 KDa
Source organism: Ovis aries
UniProt:
FASTA Sequence
Length: 79 amino acids
Theoretical weight: 8.96 KDa
Source organism: Ovis aries
UniProt:
- Canonical: A0A6P7DQB1 (Residues: 12-90; Coverage: 81%)
FASTA Sequence
>pdb|7zeb|n
SKMELPDYKQWKIEGTPLETVQEKLAARGLRDPWGRNEAWRYMGGFANNVSFVGALLKGFKWGFAAFVVAVGAEYYLES
PDBe-KB: UniProt Coverage View:
A0A6P7DQB1