PDBe-KB: UniProt Coverage View:
A0A836CQA7
![NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 11, mitochondrial in PDB entry 7zeb, assembly 1, front view.](https://www.ebi.ac.uk/pdbe/static/entry/7zeb_entity_26_front_image-200x200.png "Hetero 45-meric assembly 1 of PDB entry <span class='highlight'>7zeb</span> contains 1 copy of <span class='highlight'>NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 11, mitochondrial</span>. Front view.")
![NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 11, mitochondrial in PDB entry 7zeb, assembly 1, side view.](https://www.ebi.ac.uk/pdbe/static/entry/7zeb_entity_26_side_image-200x200.png "Hetero 45-meric assembly 1 of PDB entry <span class='highlight'>7zeb</span> contains 1 copy of <span class='highlight'>NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 11, mitochondrial</span>. Side view.")
![NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 11, mitochondrial in PDB entry 7zeb, assembly 1, top view.](https://www.ebi.ac.uk/pdbe/static/entry/7zeb_entity_26_top_image-200x200.png "Hetero 45-meric assembly 1 of PDB entry <span class='highlight'>7zeb</span> contains 1 copy of <span class='highlight'>NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 11, mitochondrial</span>. Top view.")
Chain: w
Length: 101 amino acids
Theoretical weight: 12 KDa
Source organism: Ovis aries
UniProt:
FASTA Sequence
Length: 101 amino acids
Theoretical weight: 12 KDa
Source organism: Ovis aries
UniProt:
- Canonical: A0A836CQA7 (Residues: 48-148; Coverage: 67%)
FASTA Sequence
>pdb|7zeb|w
TLRWQEDPEPEDENLYEKNPDSHGYDKDPAVDVWNMRVVFFFGFSIVLVLGSTFVAYLPDYRMQEWARREAERLVKYREAHGLPLMESNCFDPSKIQLPED
PDBe-KB: UniProt Coverage View:
A0A836CQA7