PDBe-KB: UniProt Coverage View:
A0A6P7E5N1
![NADH dehydrogenase [ubiquinone] iron-sulfur protein 7, mitochondrial in PDB entry 7zeb, assembly 1, front view.](https://www.ebi.ac.uk/pdbe/static/entry/7zeb_entity_34_front_image-200x200.png "Hetero 45-meric assembly 1 of PDB entry <span class='highlight'>7zeb</span> contains 1 copy of <span class='highlight'>NADH dehydrogenase [ubiquinone] iron-sulfur protein 7, mitochondrial</span>. Front view.")
![NADH dehydrogenase [ubiquinone] iron-sulfur protein 7, mitochondrial in PDB entry 7zeb, assembly 1, side view.](https://www.ebi.ac.uk/pdbe/static/entry/7zeb_entity_34_side_image-200x200.png "Hetero 45-meric assembly 1 of PDB entry <span class='highlight'>7zeb</span> contains 1 copy of <span class='highlight'>NADH dehydrogenase [ubiquinone] iron-sulfur protein 7, mitochondrial</span>. Side view.")
![NADH dehydrogenase [ubiquinone] iron-sulfur protein 7, mitochondrial in PDB entry 7zeb, assembly 1, top view.](https://www.ebi.ac.uk/pdbe/static/entry/7zeb_entity_34_top_image-200x200.png "Hetero 45-meric assembly 1 of PDB entry <span class='highlight'>7zeb</span> contains 1 copy of <span class='highlight'>NADH dehydrogenase [ubiquinone] iron-sulfur protein 7, mitochondrial</span>. Top view.")
Chain: 6
Length: 150 amino acids
Theoretical weight: 17.17 KDa
Source organism: Ovis aries
UniProt:
Length: 150 amino acids
Theoretical weight: 17.17 KDa
Source organism: Ovis aries
UniProt:
- Canonical: A0A6P7E5N1 (Residues: 74-223; Coverage: 67%)
>pdb|7zeb|6
VAKLDDLINWARRSSLWPMTFGLACCAVEMMHMAAPRYDMDRFGVVFRASPRQSDVMIVAGTLTNKMAPALRKVYDQMPEPRYVVSMGSCANGGGYYHYSYSVVRGCDRIVPVDIYVPGCPPTAEALLYGILQLQKKIKREKRLRIWYRR
PDBe-KB: UniProt Coverage View:
A0A6P7E5N1