PDBe-KB: UniProt Coverage View:
G0SAN0
![NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 11, mitochondrial in PDB entry 7zmg, assembly 1, front view.](https://www.ebi.ac.uk/pdbe/static/entry/7zmg_entity_25_front_image-200x200.png "Hetero 43-meric assembly 1 of PDB entry <span class='highlight'>7zmg</span> contains 1 copy of <span class='highlight'>NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 11, mitochondrial</span>. Front view.")
![NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 11, mitochondrial in PDB entry 7zmg, assembly 1, side view.](https://www.ebi.ac.uk/pdbe/static/entry/7zmg_entity_25_side_image-200x200.png "Hetero 43-meric assembly 1 of PDB entry <span class='highlight'>7zmg</span> contains 1 copy of <span class='highlight'>NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 11, mitochondrial</span>. Side view.")
![NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 11, mitochondrial in PDB entry 7zmg, assembly 1, top view.](https://www.ebi.ac.uk/pdbe/static/entry/7zmg_entity_25_top_image-200x200.png "Hetero 43-meric assembly 1 of PDB entry <span class='highlight'>7zmg</span> contains 1 copy of <span class='highlight'>NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 11, mitochondrial</span>. Top view.")
Chain: S
Length: 143 amino acids
Theoretical weight: 15.85 KDa
Source organism: Thermochaetoides thermophila DSM 1495
UniProt:
FASTA Sequence
Length: 143 amino acids
Theoretical weight: 15.85 KDa
Source organism: Thermochaetoides thermophila DSM 1495
UniProt:
- Canonical: G0SAN0 (Residues: 1706-1848; Coverage: 8%)
FASTA Sequence
>pdb|7zmg|S
MDGGPPTFAFRPTARQAPGKLSSAPVTTRLAAAALSRASTVSSKALTPARFRFFSTTQRRAGGHGMQYDPPTGWLWGVRPGEKYQNEGWEGPFFYGFWGSLIVFAIAYAYKPDTSIQTWALEEARRRLEAEGILEDPNPTKKE
PDBe-KB: UniProt Coverage View:
G0SAN0