› › Structure analysis

Cryo-EM structure of biparatopic antibody Bp109-92 in complex with TNFR2

Electron Microscopy
3.63Å resolution
PDB entry 8hlb coloured by chain, front view.
PDB entry 8hlb coloured by chain, side view.
PDB entry 8hlb coloured by chain, top view.
Source organism: Homo sapiens
Assembly composition:
hetero pentamer (preferred)
Entry contents: 5 distinct polypeptide molecules

Quick links

Assemblies

Assembly 1 (preferred)
Download    3D Visualisation
Assembly Name: Maltose/maltodextrin-binding periplasmic protein, Tumor necrosis factor-binding protein 2 and IG-heavy chain and IG-light kappa chain and IG-heavy cha...
show full assembly name
Multimeric state: hetero pentamer
Accessible surface area: 43141.38 Å2
Buried surface area: 11426.6 Å2
Dissociation area: 2,061.32 Å2
Dissociation energy (ΔGdiss): -5.39 kcal/mol
Dissociation entropy (TΔSdiss): 26.76 kcal/mol
Symmetry number: 1
PDBe Complex ID: PDB-CPX-279598

Macromolecules

Maltose/maltodextrin-binding periplasmic protein; Tumor necrosis factor-binding protein 2
Chain: A
Length: 550 amino acids
Theoretical weight: 60.45 KDa
Source organism: Homo sapiens
Expression system: Homo sapiens
Tumor necrosis factor receptor superfamily member 1B,Maltose/maltodextrin-binding periplasmic protein in PDB entry 8hlb, assembly 1, front view.
Tumor necrosis factor receptor superfamily member 1B,Maltose/maltodextrin-binding periplasmic protein in PDB entry 8hlb, assembly 1, side view.
Tumor necrosis factor receptor superfamily member 1B,Maltose/maltodextrin-binding periplasmic protein in PDB entry 8hlb, assembly 1, top view.
155050100150200250300350400450500550
 
200400LPAQVAFTPYAPEPGSTCRLREYYDQTAQMCCSKCSPGQHAKVFCTKTSDTVCDSCEDSTYTQLWNWVPECLSCGSRCSSDQVETQACTREQNRICTCRPGWYCALSKQEGCRLCAPLRKCRPGFGVARPGTETSDVVCKPCAPGTFSNTTSSTDICRPHQICNVVAIPGNASMDAVCKIEEGKLVIWINGDKGYNGLAEVGKKFEKDTGIKVTVEHPDKLEEKFPQVAATGDGPDIIFWAHDRFGGYAQSGLLAEITPDKAFQDKLYPFTWDAVRYNGKLIAYPIAVEALSLIYNKDLLPNPPKTWEEIPALDKELKAKGKSALMFNLQEPYFTWPLIAADGGYAFKYENGKYDIKDVGVDNAGAKAGLTFLVDLIKNKHMNADTDYSIAEAAFNKGETAMTINGPWAWSNIDTSKVNYGVTVLPTFKGQPSKPFVGVLSAGINAASPNKELAKEFLENYLLTDEGLEAVNKDKPLGAVALKSYEEELVKDPRIAATMENAQKGEIMPNIPQMSAFWYAVRTAVINAASGRQTVDEALKDAQGHHHHHH
UniProt
P20333
P0AEX9
Chains
Secondary structure
Sequence conservation
Molecule details ›

Search similar proteins

TR109 heavy chain
Chain: B
Length: 236 amino acids
Theoretical weight: 25.08 KDa
Source organism: Homo sapiens
Expression system: Homo sapiens
TR109 heavy chain in PDB entry 8hlb, assembly 1, front view.
TR109 heavy chain in PDB entry 8hlb, assembly 1, side view.
TR109 heavy chain in PDB entry 8hlb, assembly 1, top view.
123620406080100120140160180200220
 
100200QVQLKESGPGLVAPSQSLSITCTVSGFSLTVYGVNWVRQPPGKGLEWLGMIWGDGSTAYNSALKSRLTITKDNSKTQVFLKMNSLQTDDTARYYCARDGRRYALDYWGQGTSVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCFNTHTCPPCPAPELLG
Chains
Chain B (auth B)
Secondary structure
Interaction interfaces
Sequence conservation
Molecule details ›

Search similar proteins

TR109 light chain
Chain: C
Length: 218 amino acids
Theoretical weight: 23.85 KDa
Source organism: Homo sapiens
Expression system: Homo sapiens
TR109 light chain in PDB entry 8hlb, assembly 1, front view.
TR109 light chain in PDB entry 8hlb, assembly 1, side view.
TR109 light chain in PDB entry 8hlb, assembly 1, top view.
121820406080100120140160180200
 
100200DIVLTQSPTSLAVSLGQRATISCRASESVDSYGDSFLHWYQQKPGQPPILLIYRASNLDSGIPARFSGSGSRTDFTLTINPVEADDVATYYCQQSNEDPYTFGGGTKLEIKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC
Chains
Chain C (auth C)
Secondary structure
Interaction interfaces
Sequence conservation
Molecule details ›

Search similar proteins

TR92 heavy chain
Chain: D
Length: 238 amino acids
Theoretical weight: 25.54 KDa
Source organism: Homo sapiens
Expression system: Homo sapiens
TR92 heavy chain in PDB entry 8hlb, assembly 1, front view.
TR92 heavy chain in PDB entry 8hlb, assembly 1, side view.
TR92 heavy chain in PDB entry 8hlb, assembly 1, top view.
123820406080100120140160180200220
 
100200KVQLQQSGAELVKPGASVKLSCKASGYTFTESIIHWVKQRSGQGLEWIGWFYPGSDNINYNEKFKDKATLTADKSSSTVYMELTRLTSEDSAVYFCASHEGPYVYFDYWGQGTTLTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPELLG
Chains
Chain D (auth D)
Secondary structure
Interaction interfaces
Sequence conservation
Molecule details ›

Search similar proteins

TR92 light chain
Chain: E
Length: 214 amino acids
Theoretical weight: 23.59 KDa
Source organism: Homo sapiens
Expression system: Homo sapiens
TR92 light chain in PDB entry 8hlb, assembly 1, front view.
TR92 light chain in PDB entry 8hlb, assembly 1, side view.
TR92 light chain in PDB entry 8hlb, assembly 1, top view.
121420406080100120140160180200
 
100200DIVMTQSHKFMSTSVGDRVSITCKASQDVSTAVAWYQQKPGQSPKLLIYWTSTRHTGVPDRFTGSGSGTDYTLTISSVQAEDLALYYCQHHYSTPYTFGGGTKLEIQRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC
Chains
Chain E (auth E)
Secondary structure
Interaction interfaces
Sequence conservation
Molecule details ›

Search similar proteins

Quick links